VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

guaB

Gene Name guaB
Sequence Strain (Species/Organism) Francisella tularensis subsp. holarctica FTNF002-00
NCBI Gene ID 5523917
NCBI Protein GI 156502929
Locus Tag FTA_1563
Genbank Accession CP000803
Protein Accession YP_001428994
Taxonomy ID 458234
Gene Starting Position 1398915
Gene Ending Position 1400375
Gene Strand (Orientation) -
Protein Name inosine-5'-monophosphate dehydrogenase
Protein pI 7.79
Protein Weight 47330.3
Protein Length 486
Protein Note 1.1.1.205
DNA Sequence
>gi|156501369:1398915-1400375 Francisella tularensis subsp. holarctica FTNF002-00 chromosome, complete genome
TTTAAGACTGGTAATTAGGTGGTTCTTTAGTAATCGTGACGTTATGTACATGCGATTCATTAAATCCAGC
ACCTGTAATTTGTACAAATGTCGGTTCTGTTCGCATTGTTTGGATATCTTTTGAGCCAGTATAGCCCATA
CTAGATTTCAGACCACCTATTAGCTGATGAATCACTGCAGATAATAAACCTTTGTATGGTACTCTGCCTT
CAACGCCTTCTGGAACAAACTTTTTCGCCTCTGTTTCACTTTGGAAATATCTATCAGATGAGCCTTTCTC
CATAGCACCAAGAGAACCCATACCACGATATGATTTATAAGAGCGACCTTGGAAAAGCTCAACCTCCCCT
GGTGATTCTTCAGTACCTGCAAAAAGCCCTCCAATCATAACTACAGATGCTCCAGCAACTATAGCTTTTG
CAATATCACCGGAATATCTAATACCGCCATCTGCAATCACAGGCACTCCAGTTCCTTTTAATGCCTCTGC
AACATTAGCTATCGCTGTAATTTGTGGTACACCAACACCAGCAACAATTCTGGTAGTACAGATTGAGCCA
GGTCCAATACCAACCTTGACAGCATCAGCACCAGCTTTAACTAGATCTTTAGCAGCTTCTGCTGTAGCGA
TATTACCACCTATAACCTGAATATGTGGATAGTTATCTTTAACCCACTTAACTGTATCTAACACACCTTG
TGAATGTCCATGAGCAGTATCTACAACAATAATATCGACTCCTTCAGCTGCCAATGCTGCAACACGCTCT
TTAGTATTAACAGCGGTTCCAACAGCAGCGCCAACTCTCAAACGCCCAAGAGAATCTTTACAAGCATTTG
GTTTATTTTGTGATCTTTCGATATCTTTTGTTGTAATAAGACCGACCAACTCGCCTTGTTCATTAACTAC
AAGCAACTTCTCAATTTTATGCTCATGAAGTTTCTTTTTAATCGCTCCTTGAGAAGCATCTTCAGGCACT
GTTACAAGTTTTTCTCTAGGTGTCATAATAGAGCTAACAGGTTCATCTAAATCTTTTGCAAATCTAAAAT
CACGCCTTGTAACAATACCTATGATTTTATTATTATCATCAACAACGGGAAAACCAGAGAAATTATGTTC
TTTAGCTAGTTGCATGATTTCTTTAATTGAGCTTTCTTGTTTAATGGTAATGGGATCAATCACCATTCCA
TTTTCAAATCTTTTTACCTTTTTAACTTCTTGGGCTTGGGCTTGAATAGACATATTCTTATGAATAATAC
CAATACCACCTTCCTGGGCTATCGCAATAGCTAGGCGTGACTCAGTAACCGTATCCATAGCTGCAGATAC
TAAAGGAATATTTAACTGAATATCTCTAGTTATATTTGTCTTCAAATCAACTTGATGAGGAAGAACATTT
GAATATCTAGGTGATAGCAATACATCATCAAAAGTGATTGCCTGCTGAGTAATTCTTAACA
Protein Sequence
>gi|156502929|ref|YP_001428994.1| inosine-5'-monophosphate dehydrogenase [Francisella tularensis subsp. holarctica FTNF002-00]
MLRITQQAITFDDVLLSPRYSNVLPHQVDLKTNITRDIQLNIPLVSAAMDTVTESRLAIAIAQEGGIGII
HKNMSIQAQAQEVKKVKRFENGMVIDPITIKQESSIKEIMQLAKEHNFSGFPVVDDNNKIIGIVTRRDFR
FAKDLDEPVSSIMTPREKLVTVPEDASQGAIKKKLHEHKIEKLLVVNEQGELVGLITTKDIERSQNKPNA
CKDSLGRLRVGAAVGTAVNTKERVAALAAEGVDIIVVDTAHGHSQGVLDTVKWVKDNYPHIQVIGGNIAT
AEAAKDLVKAGADAVKVGIGPGSICTTRIVAGVGVPQITAIANVAEALKGTGVPVIADGGIRYSGDIAKA
IVAGASVVMIGGLFAGTEESPGEVELFQGRSYKSYRGMGSLGAMEKGSSDRYFQSETEAKKFVPEGVEGR
VPYKGLLSAVIHQLIGGLKSSMGYTGSKDIQTMRTEPTFVQITGAGFNESHVHNVTITKEPPNYQS
Molecule Role Virmugen
Molecule Role Annotation A guaB mutant is attenuated in mice and induces significant protection from challenge with parent strain F. tularensis LVS (Santiago et al., 2009).
Related Vaccines(s) Francisella tularensis guaB mutant vaccine
References