VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

E

Gene Name E
Sequence Strain (Species/Organism) Severe acute respiratory syndrome-related coronavirus
NCBI Gene ID 1489671
NCBI Protein GI 29836499
Locus Tag sars4
Protein Accession NP_828854
Taxonomy ID 694009
Gene Starting Position 26116
Gene Ending Position 26346
Gene Strand (Orientation) +
Protein Name protein E
Protein pI 6.3
Protein Weight 6972.52
Protein Length 76
Protein Note E. coli expression reported by Shen et al. (2003)
DNA Sequence
>gi|30271926:26116-26346 SARS coronavirus, complete genome
TATGTACTCATTCGTTTCGGAAGAAACAGGTACGTTAATAGTTAATAGCGTACTTCTTTTTCTTGCTTTC
GTGGTATTCTTGCTAGTCACACTAGCCATCCTTACTGCGCTTCGATTGTGTGCGTACTGCTGCAATATTG
TTAACGTGAGTTTAGTAAAACCAACGGTTTACGTCTACTCGCGTGTTAAAAATCTGAACTCTTCTGAAGG
AGTTCCTGATCTTCTGGTCTA
Protein Sequence
>gi|29836499|ref|NP_828854.1| protein E [Severe acute respiratory syndrome-related coronavirus]
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEG
VPDLLV
Molecule Role Virmugen
Molecule Role Annotation An E mutant is attenuated in hamsters and induces significant protection from challenge with wild type SARS (Lamirande et al., 2008).
Related Vaccines(s) SARS-CoV E gene mutant vaccine
References