VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

cen1

Gene Name cen1
NCBI Protein GI 15488542
Other Database IDs CDD:185503
CDD:28933
Taxonomy ID 5661
Gene Strand (Orientation) ?
Protein Name centrin
Protein Length 149
Protein Note centrin; Provisional
Protein Sequence
>gi|15488542|gb|AAL01153.1|AF406767_1 centrin [Leishmania donovani]
MAALTDEQIREAFNLFDADGSGAIDAEEMALAMKGLGFGDLSRDEVERIIRSMHTDSNGLVAYGEFEAMV
KSRMAQKDSPEEILKAFQLFDLDKKGKISFANLKEVAKLLGENPGDDVLKEMIAEADEDGDGEVSFEEFK
SVMLHMRGK
Molecule Role Virmugen
Molecule Role Annotation A cen1 mutant is attenuated in mice and hamsters and induces significant protection from challenge with wild type L. donovani (Selvapandiyan et al., 2009).
Related Vaccines(s) Leishmania donovani cen1 mutant vaccine
References