VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

C protein

Gene Name C protein
Sequence Strain (Species/Organism) Tick-borne encephalitis virus
NCBI Protein GI 206570298
Other Database IDs CDD:110034
Taxonomy ID 11084
Gene Strand (Orientation) ?
Protein Name capsid protein
Protein Length 35
Protein Note Flavivirus capsid protein C; pfam01003
Protein Sequence
>gi|206570298|gb|ACI12930.1| capsid protein [Tick-borne encephalitis virus]
MARKAILKGKGGGPPRRVSKETAKKTRQSRVQMPN
Molecule Role Virmugen
Molecule Role Annotation A virus with a mutation in protein C is attenuated in mice and induced protection from challenge with wild type TBE virus (Kofler et al., 2002).
Related Vaccines(s) Tick-borne Encephalitis Virus C protein mutant vaccine
References