VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

C protein

Gene Name C protein
Sequence Strain (Species/Organism) West Nile virus
NCBI Protein GI 158516889
Other Database IDs CDD:144552
VBRC:36387
Taxonomy ID 11082
Gene Strand (Orientation) ?
Protein Name capsid protein
Protein Length 105
Protein Note lineage 1; Vero cell passage 2 after isolation
Protein Sequence
>gi|158516889|ref|YP_001527878.1| capsid protein [West Nile virus]
MSKKPGGPGKSRAVNMLKRGMPRVLSLIGLKRAMLSLIDGKGPIRFVLALLAFFRFTAIAPTRAVLDRWR
GVNKQTAMKHLLSFKKELGTLTSAINRRSSKQKKR
Molecule Role Virmugen
Molecule Role Annotation A virus with a C protein mutation is attenuated in mice and induces significant protection from challenge with wild type West Nile virus (Schlick et al., 2010)
Related Vaccines(s) West Nile virus C protein mutant vaccine
References