VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

guaB from S. enteritidis str. P125109

Gene Name guaB from S. enteritidis str. P125109
Sequence Strain (Species/Organism) Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
NCBI Gene ID 6949287
NCBI Protein GI 207857921
Locus Tag SEN2491
Genbank Accession AM933172
Protein Accession YP_002244572
Taxonomy ID 550537
Gene Starting Position 2625484
Gene Ending Position 2626950
Gene Strand (Orientation) -
Protein Name inosine 5'-monophosphate dehydrogenase
Protein pI 6.59
Protein Weight 47186.87
Protein Length 488
Protein Note catalyzes the synthesis of xanthosine monophosphate by the NAD+ dependent oxidation of inosine monophosphate
DNA Sequence
>gi|207855516:2625484-2626950 Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 chromosome, complete genome
ATCAGGAGCCCAGACGGTAGTTCGGGGACTCTTTGGTGATGGTCACGTCGTGAACGTGGCTTTCCTGGAT
ACCCGCACCGCTGATACGCACAAACTCCGCTTTAGTACGCAGTTCGTCGATGGTAGCACAACCGGTCAGC
CCCATACAGGAGCGCAGGCCGCCCATCTGCTGGTGAATGATCTCTTTCAGGCGACCTTTATAGGCTACGC
GGCCTTCGATACCTTCCGGCACCAGTTTGTCGGCGGCGTTGTCGCTCTGGAAGTAACGGTCGGAGGAACC
TTTGGACATCGCGCCCAGAGAACCCATACCGCGATAAGATTTGTAAGAACGGCCCTGGTAGAGTTCGATT
TCGCCCGGGGATTCTTCGGTACCGGCCAGCATAGAACCCACCATTACCGCGCTCGCGCCTGCGGCGATGG
CTTTGGCGATGTCGCCGGAGAAACGGATACCGCCGTCAGCGATAACCGGAATCCCGGTGCCTTCCAGCGC
TTCCACCGCGTCAGAAACAGCGGTGATCTGCGGAACGCCCACACCAGTCACGATACGAGTCGTACAGATG
GAACCCGGGCCGATACCCACTTTCACCGCGCTGCAACCGGCTTCCGCCAGTGCGCGAGCGCCTGCGCCCG
TCGCAACGTTGCCGCCGATGATTTGCAGGTCAGGATATTTAGCACGCGTCTCACGGATACGTTGCAACAC
GCCTTCAGAGTGACCGTGAGAGGAGTCGATCAGCAGTACGTCAACGCCTGCCGCCACCAGCGCGTCAACG
CGCTCTTCGTTGCCCGCGCCTGCGCCGACCGCCGCGCCGACACGTAAACGGCCCTGCTCATCTTTACAGG
AGTTTGGTTTACGTTCCGCTTTCTGGAAATCTTTTACGGTAATCATGCCAAGCAGATGGAAGTTATCATC
AACGACCAGCGCTTTTTCTACGCGTTTTTCGTGCATTTTTGCCAGCACGACTTCACGGGCTTCGCCTTCA
CGAACGGTCACCAGACGCTCTTTCGGTGTCATGTAGACACTCACCGGCTGGTTCAGGTCAGTCACAAAAC
GCACGTCACGACCGGTGATGATACCCACCAGCTCGTTATCTTCAGTCACCACCGGATAGCCCGCAAAACC
GTTACGCTCGGTCAGGGCTTTCACTTCATGCAACGTGGTGGTTGGCAGGACGGTCTGCGGGTCGGTCACT
ACGCCGGACTCGTGTTTCTTCACGCGGCGAACTTCTTCCGCCTGGCGCTCAATAGACATGTTTTTGTGGA
TAAAACCAATGCCGCCTTCCTGGGCCAGGGCAATTGCCAGGCGCGCTTCCGTCACGGTGTCCATCGCCGC
AGAAAGCATAGGAATATTCAGACGAATAGTTTTCGTCAACTGCGTGCTGAGATCGGCAGTATTCGGCAAA
ACGGTGGAGTGAGCGGGAACAAGGAGGACGTCGTCAAACGTCAGAGCTTCTTTAGCGATACGTAGCA
Protein Sequence
>gi|207857921|ref|YP_002244572.1| inosine 5'-monophosphate dehydrogenase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
MLRIAKEALTFDDVLLVPAHSTVLPNTADLSTQLTKTIRLNIPMLSAAMDTVTEARLAIALAQEGGIGFI
HKNMSIERQAEEVRRVKKHESGVVTDPQTVLPTTTLHEVKALTERNGFAGYPVVTEDNELVGIITGRDVR
FVTDLNQPVSVYMTPKERLVTVREGEAREVVLAKMHEKRVEKALVVDDNFHLLGMITVKDFQKAERKPNS
CKDEQGRLRVGAAVGAGAGNEERVDALVAAGVDVLLIDSSHGHSEGVLQRIRETRAKYPDLQIIGGNVAT
GAGARALAEAGCSAVKVGIGPGSICTTRIVTGVGVPQITAVSDAVEALEGTGIPVIADGGIRFSGDIAKA
IAAGASAVMVGSMLAGTEESPGEIELYQGRSYKSYRGMGSLGAMSKGSSDRYFQSDNAADKLVPEGIEGR
VAYKGRLKEIIHQQMGGLRSCMGLTGCATIDELRTKAEFVRISGAGIQESHVHDVTITKESPNYRLGS
Molecule Role Virmugen
Molecule Role Annotation A guaB mutant, in combination with a fliC mutant, is attenuated in mice and chickens and induced significant protection from challenge with wild type S. enterica (Adriaensen et al., 2007).
Related Vaccines(s) Salmonella enterica fliC/guaB mutant vaccine , Salmonella Enteritidis guaBA/clpP mutant vaccine
References