VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

fliC

Gene Name fliC
Sequence Strain (Species/Organism) Salmonella enterica subsp. enterica serovar Enteritidis
NCBI Protein GI 119351647
Other Database IDs CDD:181201
Taxonomy ID 149539
Gene Strand (Orientation) ?
Protein Name FliC
Protein Length 157
Protein Note PT1
Protein Sequence
>gi|119351647|gb|ABL63539.1| FliC [Salmonella enterica subsp. enterica serovar Enteritidis]
GETITIDLQKIDVKSLGLDGFNVNGPKEATVGDLKSSFKNVTGYDTYAAGADKYRVDINSGAVVTDAAAP
DKVYVNAANGQLTTDDAENNTAVDLFKTTKSTAGTAEAKAIAGAIKGGKEGDTFDYKGVTFTIDTKTGDD
GNGKVSTTINGEKVTLT
Molecule Role Virmugen
Molecule Role Annotation A fliC mutant, in combination with a guaB mutant, is attenuated in mice and chickens and induces significant protection from challenge with wild type S. enterica (Adriaensen et al., 2007).
Related Vaccines(s) Salmonella enterica fliC/guaB mutant vaccine
References