VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign2
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

ler

Gene Name ler
Sequence Strain (Species/Organism) Escherichia coli O157:H7 str. TW14359
NCBI Gene ID 8219269
NCBI Protein GI 254795663
Locus Tag ECSP_4703
Genbank Accession CP001368
Protein Accession YP_003080500
Taxonomy ID 544404
Gene Starting Position 4678930
Gene Ending Position 4679301
Gene Strand (Orientation) -
Protein Name enterocyte effacement (LEE)-encoded regulator
Protein pI 4.97
Protein Weight 13635.36
Protein Length 123
DNA Sequence
>gi|254791136:4678930-4679301 Escherichia coli O157:H7 str. TW14359, complete genome
GTTAAATATTTTTCAGCGGTATTATTTCTTCTTCAGTGTCCTTCACAAGAAAATCTTCTTTCTTCATTCC
ATTCAACAGTGCTTCTTTAAGCCAGCGTGGCTGTCGGCCTACGCCCGACCAGGTCTGCCCTTCTTCATTG
CGGTAGTAAACACCTTTCGATGAGTTCCGGCGAGCGAGTCCATCATCAGGCACATTAGTATATCCCAGCT
CTTGTAAGGTTATATTGTAATAAGTAATCTGCTTCTGAATCGACTCAATTACACTTTGAACTTCCTGCTC
TCGCAGTCGCTTTGCTTCCTGCTGTAGAACTGCAATTTGCTCTATAAGCTGAATGTATGGACTTGTTGTA
TGTGAATTATTTTCCATATTCA
Protein Sequence
>gi|254795663|ref|YP_003080500.1| locus of enterocyte effacement (LEE)-encoded regulator [Escherichia coli O157:H7 str. TW14359]
MNMENNSHTTSPYIQLIEQIAVLQQEAKRLREQEVQSVIESIQKQITYYNITLQELGYTNVPDDGLARRN
SSKGVYYRNEEGQTWSGVGRQPRWLKEALLNGMKKEDFLVKDTEEEIIPLKNI
Molecule Role Virmugen
Molecule Role Annotation A ler deletion mutant derived from wild-type EHEC O157:H7 86-24 was constructed by use of suicide vector pCVD442. Following challenge of 7-day-old suckling mice with O157:H7 EDL933, 75.2% born to group B mothers (immunized with F25) sur- vived, as did 83.0% born to group C mothers (immunized with F105). The surviving suckling mice consistently gained body weight. Only 16.8% of sucking mice born to control group mice survived the challenge (Liu et al., 2009).
Related Vaccines(s) Escherichia coli ler mutant vaccine
References