VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

capB

Gene Name capB
Sequence Strain (Species/Organism) Francisella tularensis subsp. holarctica LVS
NCBI Gene ID 3952402
NCBI Protein GI 89256709
Locus Tag FTL_1416
Genbank Accession AM233362
Protein Accession YP_514071
Taxonomy ID 376619
Gene Starting Position 1344798
Gene Ending Position 1346006
Gene Strand (Orientation) -
Protein Name capsule biosynthesis protein capB
Protein pI 7.41
Protein Weight 41305.26
Protein Length 402
DNA Sequence
>gi|89255449:1344798-1346006 Francisella tularensis subsp. holarctica LVS chromosome, complete genome
ACTATAAATTATGCTTCTTTTTATGGCTAGTATCACAGTAATCAACTAATTCCATACCAATATCTTTAAT
ATTACCAACTCCAACAAGAATATAAGAGTTTGCTGGATTTGAATCAACTGTTTTTTCAAGTATTTGTATA
GGTGTCATCTCTTCACAAACTATGACTTTAGTCATTGGTTTATTAAGTGATTTTGCATATTTTTTATAAA
ACGAAGTAAAAACCTCTGTACCAGTACCTATTAGAACAATTAAATCTTGTTTTTGCCAACCTAGAGCTGC
TTCTGCCATTTGTTTTGAGCGATCCTCTCTATCATCTCTACAGTTAACAACCAATACTTTCTTATCACAG
CCTGAATACTTAGCACAAAGCTTATCCCAAAGCATTTTTGTTGATACAGGATCATTAGCAGCAAAAGCAT
TAGCAAAATTTATTTCAGCATTTTTAATATTAAAATTATACTCCGTCATCGCACCTGGATCTGGGGTCGC
TTCCCACATTCCTTTAAGAGCGATCTCTCTAGGTATACCCAAATCATCTGTTACTTTTAATGCTAGAGCA
ACATTTATCTTAAATTCTGAGTATACAAACTTATTTATTTCTTCATCAGATATTTTCTCAGCATCTTGTG
CTGTAGCTGCGATTAGTTCTGAGCCTCGGTCTTTACAAGCATATTCAAAAAAATCTAAATGGATATCTTC
CGCAGTAAAATACTTAGCTCCAACAGGGATAGTAGCTGCTAATGCTTTTGCAACATCTCTTTCTGTAGGA
CCCATAACATCTAAATGATCAGGACGAGCATTTGTCAAAACTCCATGTGTCGCTTTAATAAGCTTTAACT
CACACAGCGATTGCAAAAGTGGCTGCAAAGCCATACACTCGATAACGATAGCATCAGCTTTTGCTCTTCT
TGCCTTAAACATAATCTTAACTTGCTCAGCAATATTACTAAAACCTATTCTAAATACAGGTGTTTCTGAA
CCATCAACATCAATATATCTTGCTAAAGTTCCAGTAGTCTTAGCTACTGTTCTATATCCTCCAGCTCTAA
CACCAGCTGCAATAAGTCTCGCAACACTTGACTTACCACGAGTACCATTGACATGAATCCTAATAGGAAT
ACTTTTAATACTATTATTATGCACTATATTTTCTATTATTAGATAAACGCATAAAATCACAAATACGACG
ACAATTAACCAAAAATCCA
Protein Sequence
>gi|89256709|ref|YP_514071.1| capsule biosynthesis protein capB [Francisella tularensis subsp. holarctica LVS]
MDFWLIVVVFVILCVYLIIENIVHNNSIKSIPIRIHVNGTRGKSSVARLIAAGVRAGGYRTVAKTTGTLA
RYIDVDGSETPVFRIGFSNIAEQVKIMFKARRAKADAIVIECMALQPLLQSLCELKLIKATHGVLTNARP
DHLDVMGPTERDVAKALAATIPVGAKYFTAEDIHLDFFEYACKDRGSELIAATAQDAEKISDEEINKFVY
SEFKINVALALKVTDDLGIPREIALKGMWEATPDPGAMTEYNFNIKNAEINFANAFAANDPVSTKMLWDK
LCAKYSGCDKKVLVVNCRDDREDRSKQMAEAALGWQKQDLIVLIGTGTEVFTSFYKKYAKSLNKPMTKVI
VCEEMTPIQILEKTVDSNPANSYILVGVGNIKDIGMELVDYCDTSHKKKHNL
Molecule Role Virmugen
Molecule Role Annotation There was a deletion in gene capB of F. tularensis live vaccine strain. LVS capB, while much less virulent than LVS, induces potent protective immunity against lethal LVS i.n. challenge in mice, comparable to that induced by LVS (Jia et al., 2010).
Related Vaccines(s) Francisella tularensis capB mutant vaccine
References