VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

exsA

Gene Name exsA
Sequence Strain (Species/Organism) Brucella melitensis biovar Abortus 2308
NCBI Gene ID 3787220
NCBI Protein GI 82699354
Locus Tag BAB1_0468
Genbank Accession AM040264
Protein Accession YP_413928
Taxonomy ID 359391
Chromosome No I
Gene Starting Position 459774
Gene Ending Position 461660
Gene Strand (Orientation) +
Protein Name ABC transporter ATPase
Protein pI 7.04
Protein Weight 65025
Protein Length 628
Protein Note identified by match to protein family HMM PF00005; match to protein family HMM PF00664
DNA Sequence
>gi|82698932:459774-461660 Brucella melitensis biovar Abortus 2308 chromosome chromosome I, complete sequence
GATGAATGCCCCCAAGACGGTTTCTGCCGAATCCGGCGAGACGCTGAAAACATTGCGAAATCTGTGGCCC
TACATGTGGCCGTCCGACAGGCCGGACCTGCGAATGCGCGTGGTCTGGGCCACATTCTATCTGGTTCTGT
CCAAGATTGTGCTGATCCTCGTACCCTATTTCTTCAAATGGGTGACCAATGCGCTGAACGGCCAGCTTCA
TGCGCCGGATTATATTCCGGTCGTTCTGGTCGGCGCGGTCATGCTGGTGCTGGCCTATAATGCGGCGAAA
ATCGTGCAGGCTGGCCTCAACCAGCTTCGTGACGCACTTTTTGCCAGTGTTGGCCAATATGCGGTGCGCC
AGCTTGCCTACAAGACCTTTGTGCATATGCATGAGCTTTCGCTGCGCTTTCATCTGGAGCGGCGCACGGG
CGGCCTGTCGCGCGTCATCGAGCGCGGCACCAAGGGCATTGAAACCATCGTCCGTTTTACCATCCTGAAC
ACGCTGCCTACCATTCTGGAATTTGCGCTGACGGCGGTGATCTTCGCTTTCGCCTATGGCCTGTCCTATC
TCGTGGTCGTGGCGGCGACGGTCTGGCTCTATACGTGGTTCACCATCAGGGCGAGCGATTGGCGCATCAA
TATCCGTCGCGAGATGAACGATTCCGATACCGACGCCAATACCAAGGCCATCGATTCGCTTCTCAACTTC
GAGACGGTCAAATATTTCGGCAATGAAGCGATGGAGGCCAAGCGTTTCGATGGGGCTATGGCGCGATATG
AAAAGGCTGCAACCCAGACCTGGACCTCGCTTGGCTGGCTGAACTTCGGTCAGGCCGTGATTTTCGGCGC
GGGCATGGCCATTGTCATGGTCATGTCGGCCATGGAGGTGCAGAAGGGCACACAGTCGCTGGGCGATTTC
GTCTTCATCAATGCGCTTTTGATGCAGCTTTCCATCCCGCTCAATTTCATCGGCTTTATCTATCGTGAAA
TCCGTCAGGGCCTCACCGATATCGAGCAGATGTTCGACCTTCTGGACGTCAAGCAGGAAGTGAAAGACAA
GCCCGGCGCTCCTGCGCTGAAAGTCGATAGCGGCGCAATCTCCTTCAAGGATGTGCACTTTGCCTATGAT
CCGCAGCGCCCCATCCTGCGCGGCATCAGCTTCGACGTTCCCGCAGGAAAGACGGTGGCGATTGTCGGCC
CTTCGGGGGCTGGTAAATCCACCATATCGCGGCTTCTGTTCCGCTTTTACGATATCCAGTCCGGTTCGAT
CACCATCGATGGGCAGGATGTGCGCGACGTGACCCAGGAAAGCCTGCGCAAGTTTATCGGCATGGTGCCG
CAGGATACGGTCCTGTTCAACGACACCATCGCCTATAATATCCGCTATGGCCGCACCGATGCGAGCGAGG
AGGATGTGGAAAAAGCAGCCGAGCTCGCGCAGATTGCCGGCTTCATCAAGCATCTGCCGGATGGCTACAA
ATCCATGGTTGGCGAGCGCGGCCTGAAGCTTTCCGGCGGCGAAAAGCAGCGTGTGGCGATTGCCCGCACG
ATCCTCAAGGCCCCGCCTATTCTTATTCTGGACGAGGCGACCTCGGCACTCGATACCGCGACCGAGCAGG
ACATCCAGTCGGCGCTTGATATTGTCAGCCGCGGGCGCACCACGCTGGTGATCGCGCATCGCCTTTCCAC
CGTGATCGGTGCGGATGAGATCATCGTCCTGAAAGACGGCCTGATCGCCGAGTGCGGCACGCACCGCCAT
CTCCTTGACCAGAAGGGGCTTTATGCTTCCATGTGGGATCGCCAGCGCGAGGCGAGCGAGGCTGAGGAGC
GCCTGCGCCAGGTGCGTGAAAGCGACGATATGGGCGTGGTTCTGCGCGGGACGCCGGCGGCGGAATA
Protein Sequence
>gi|82699354|ref|YP_413928.1| ABC transporter ATPase [Brucella melitensis biovar Abortus 2308]
MNAPKTVSAESGETLKTLRNLWPYMWPSDRPDLRMRVVWATFYLVLSKIVLILVPYFFKWVTNALNGQLH
APDYIPVVLVGAVMLVLAYNAAKIVQAGLNQLRDALFASVGQYAVRQLAYKTFVHMHELSLRFHLERRTG
GLSRVIERGTKGIETIVRFTILNTLPTILEFALTAVIFAFAYGLSYLVVVAATVWLYTWFTIRASDWRIN
IRREMNDSDTDANTKAIDSLLNFETVKYFGNEAMEAKRFDGAMARYEKAATQTWTSLGWLNFGQAVIFGA
GMAIVMVMSAMEVQKGTQSLGDFVFINALLMQLSIPLNFIGFIYREIRQGLTDIEQMFDLLDVKQEVKDK
PGAPALKVDSGAISFKDVHFAYDPQRPILRGISFDVPAGKTVAIVGPSGAGKSTISRLLFRFYDIQSGSI
TIDGQDVRDVTQESLRKFIGMVPQDTVLFNDTIAYNIRYGRTDASEEDVEKAAELAQIAGFIKHLPDGYK
SMVGERGLKLSGGEKQRVAIARTILKAPPILILDEATSALDTATEQDIQSALDIVSRGRTTLVIAHRLST
VIGADEIIVLKDGLIAECGTHRHLLDQKGLYASMWDRQREASEAEERLRQVRESDDMGVVLRGTPAAE
Molecule Role Virmugen
Molecule Role Annotation Brucella DeltaexsA mutant showed decreased survival in mice compared to the survival of parental strain S2308. This demonstrated that ExsA is critical for full bacterial virulence. The B. abortus exsA deletion mutant was used as a live vaccine candidate. Challenge experiments revealed that the exsA mutant strain induced superior protective immunity in BALB/c mice compared to the protective immunity induced by strain S19 or RB51 (Rosinha et al., 2002a).
Related Vaccines(s) Brucella abortus exsA mutant vaccine
References