VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

purE

Gene Name purE
Sequence Strain (Species/Organism) Brucella melitensis bv. 1 str. 16M
NCBI Protein GI 600729
Locus Tag BMEI0295
Genbank Accession NZ_GG703781
Protein Accession NP_539212
Other Database IDs CDD:200634
Taxonomy ID 29459
Chromosome No I
Gene Starting Position 308233
Gene Ending Position 309321
Gene Strand (Orientation) -
Protein Name 5'-phosphoribosyl-5-amino-4-imidazole carboxylase
Protein pI 5.29
Protein Weight 36300.44
Protein Length 161
Protein Note AIR carboxylase; cl00310
DNA Sequence
>gi|17986284:308233-309321 Brucella melitensis bv. 1 str. 16M chromosome chromosome I, complete sequence
CTTAAATTGTGCGGGGCTTTATGCGGGTCACATGGCCTATTTTCCGGCCCGCGCGAGCTTCCTTTTTACC
GTAAAGATGCAGCACGGCGTTCTTCTCGCAGAGAATCGCCGGAACCTTTTCGATATCGTCGCCAATCAGG
TTTTCCATCACACAGTCGCTATGGCGATCCGTATTGCCGAGCGGCAGTCCCGCCACAGCGCGGATATGCT
GCTCAAATTGGGAAATGGCGCAGGCTGCTTCCGTCCAGTGGCCCGAATTATGCACACGCGGGGCAAATTC
ATTGGCGAGCAGCGTGCCGTCCTTCAGCACGAAGAATTCAAGCCCCAGCACACCGACATAGTCCAGCGCG
TGCAACAGTTTTTCGGCGGCTGTGCGCGCGGCTTCTGCCGTCTGTACGCTGATCGCGGCAGGCACTGTGG
ACGTGGCGAGAATGCCATCCTTGTGGACGTTTTCCGCAAGATCGAAGATGGCGACATTGCCGCTGCGATC
GCGCGCGGCGATGACGGAGACTTCGCGCTCGAATTCCACGAAGCCTTCGAGAATCGCAGGCGCCTTGTTG
ATGGCTGCAAAAGCGTTGCAGGCCTGGGTTTCATCGAGGGAGGCAAGGCGCACCTGCCCCTTGCCGTCAT
AACCCAGACGCCGTATCTTGAGGATGCCACGCCCGCCCAGTGCGCCGAGCGCGGCGATGAGCGTTTCCTC
GTCATCCACGAGCCGCCAGGGCGCGGTTTCAATGCCGCTTTCGTTGAGAAACTGCTTTTCTGTGAAGCGG
TCCTGAGAGATTTCCAGTGCGGCGGGCGGGGGCAGAACAAGCGCCGTTTCAGCCAGCTTGTCGGCGGCGC
TGACTGGCACATTTTCAAATTCATAGGTGATGACGTCGGAAGCGGCGGCAAGTTCGGCCAGCGCCTTCGG
GTCATCATAGGCGGCGACAATCTGGCGATTGGCAACCTGTGCTGCCGGGCAACCGGCCTGCGGCTCAAGG
ATTATGGTTTCATAACCGAAGCGCGCCGCTGCCATGGCGAGCATACGGCCAAGCTGGCCCCCGCCGATAA
TGCCGATGGTGGAGCCGGGCTTGAGAGATGTCTTGTCCA
Protein Sequence
>gi|600729|gb|AAA57002.1| 5'-phosphoribosyl-5-amino-4-imidazole carboxylase [Brucella melitensis]
MSVDVAIIMGSQSDWETMHHAADTLEALGISFDARIVSAHRTPDRLVAFAKGAKREGFKVIIAGAGRAHL
PGMAAAMTPLPVFGVPVQSKALSGQDSLLSIVQMPAGIPVGTLAIGRAGAVNAALLAAAVLALYDEALAA
RLDEWRKAQTESVAERPSNEA
Molecule Role Virmugen
Molecule Role Annotation Mice were infected with delta purE201 or wild type parent strain 16M. The number of bacteria in the spleen and spleen weight peaked for both strains between 1 and 2 weeks postinfection (p.i.), though the number of delta purE201 cells was significantly less than the number of 16M cells recovered from the spleens of infected mice (Crawford et al., 1996). Later, a purE/purK mutant demonstrated protection from challenge with wild type B. melitensis (Hoover et al., 1999).
Related Vaccines(s) B. melitensis WR201 (16MĪ”purEK)
References