VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

siaD

Gene Name siaD
Sequence Strain (Species/Organism) Neisseria meningitidis MC58
NCBI Gene ID 903210
NCBI Protein GI 15677983
Locus Tag NMB0067
Genbank Accession AE002098
Protein Accession NP_273131
Taxonomy ID 122586
Gene Starting Position 76612
Gene Ending Position 77289
Gene Strand (Orientation) -
Protein Name polysialic acid capsule biosynthesis protein SiaD
Protein pI 10.48
Protein Weight 25814.56
Protein Length 225
Protein Note identified by similarity to GP:530041
DNA Sequence
>gi|77358697:76612-77289 Neisseria meningitidis MC58, complete genome
CTTAATCGCCTTGCAGCACATCCCCCTTTCGCCAGGCAAAAAACCGGTTATATTTTTTTGCATTAAATAT
TTTTTTAGCATATTCAGGAAAGGGGACATGCAATATGTCAAAATGATCTATATATCCTTTAATATTAAGA
TTATTTCCAATCAAATAACGTTCTAATTTTGTTGGATGATATGAAAATGATTCTAATAAAGGAGCATATG
TTCCAGTCCCTTCATCAATTAAATGAGTCGTAATATTCTTTTTTTTTGCAATACTAATCAGATAGGAGTA
GTGGCCTGTAAAAGACAGCATATAGAGATGAGCAGGCTGTATAATATTAAGGATTTTTTTGTAACTTCTA
TAAATATAAAGTAATTTTTTAGGAGTTATATTATTAGGGCTTCTAGGAAGCTCAAATAGATAAATAGATT
CAAATAGATTCTTGTTAGCTGATTGATGAACTAACTTAGGCATTTTTAAGTTTTTAGAAGTATATAAAAT
TACTAGTAAATTATTGGTTAATTTTTGTATTTTAATTAGGCTTTGGACTTGGTTAAGCTGACCTAAATTA
GATATGACAAATAAATTGTTACGTGGGGGGGTAAGATAAAATGGAGATGTTGTCAACCACATTGAATCTT
GAAAAAACTTTTTAGGCTGAAAAAGAGCTTTTTTTATTTTCTTTAGCA
Protein Sequence
>gi|15677983|ref|NP_273131.1| polysialic acid capsule biosynthesis protein SiaD [Neisseria meningitidis MC58]
MLKKIKKALFQPKKFFQDSMWLTTSPFYLTPPRNNLFVISNLGQLNQVQSLIKIQKLTNNLLVILYTSKN
LKMPKLVHQSANKNLFESIYLFELPRSPNNITPKKLLYIYRSYKKILNIIQPAHLYMLSFTGHYSYLISI
AKKKNITTHLIDEGTGTYAPLLESFSYHPTKLERYLIGNNLNIKGYIDHFDILHVPFPEYAKKIFNAKKY
NRFFAWRKGDVLQGD
Molecule Role Virmugen
Molecule Role Annotation A siaD mutant, in combination with either a metH or rfaF mutation, is attenuated in mice and induces protection from challenge with wild type N. meningitidis (Li et al., 2004).
Related Vaccines(s) Neisseria meningitidis metH/siaD mutant vaccine , Neisseria meningitidis rfaF/siaD mutant vaccine
References