VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

rfaF

Gene Name rfaF
Sequence Strain (Species/Organism) Neisseria meningitidis MC58
NCBI Gene ID 904029
NCBI Protein GI 15677379
Locus Tag NMB1527
Genbank Accession AE002098
Protein Accession NP_274534
Taxonomy ID 122586
Gene Starting Position 1577173
Gene Ending Position 1578183
Gene Strand (Orientation) -
Protein Name ADP-heptose:LPS heptosyltransferase II
Protein pI 7.02
Protein Weight 35354.86
Protein Length 336
Protein Note identified by similarity to EGAD:40767; match to protein family HMM PF01075; match to protein family HMM TIGR02195
DNA Sequence
>gi|77358697:1577173-1578183 Neisseria meningitidis MC58, complete genome
ATCATACCGCCTCTTCAACCGCCTGCACAATCTTCTCGGGATACAGCCTGTTGAGGCAGTCGGTATGCCC
CAGCGGACATTCCCGCTTAAAACACGGCGAACATTCCAAGTGCAGGCTGACGATTTTCGCCCTATCGCTC
AAAGGCGGCGTATGCGTCGGGCTGGAAGAACCGTAAACCGCCACCACCTTCCTGCCCAAAGCTGCCGCCA
AATGCATCAATCCGCTGTCGTTACACACGACCGTGTCCGCCAACGACAGCAAATCCATTGCCTGCGACAA
ATCGGTTTTGCCGCACAAATTGACACACATACCGTCTGAAAGGCGGTTGATTTCCTCGGCAATTTCATCA
TCTTTTTGCGAACCGAACAGCCAAACCTGCCAACCCGCCGCCAGATAATGTTTGCCCAACTCGGCAAAAT
GCCTTGTCGGCCAACGCTTTGCCGGCCCGAATTCCGCACCCGGACAAAAAGCCAGAACAGGCTTTCCAAT
ATCCAAGCCAAAGGTTTCGACAGAAATTTCCCGCCGCCGTTCATCAATGGAAAACTCGGGGAATCCCGAA
TGCCCGTCAAAATCTTCCTGACTCGGATGCGCGAGAGCCGTATATCGATCCACCATCAAAGGCAGACGTT
CCTTATCCAGCCTGCGTATATCGTTCAACAGAAAATAACGGCTTTCACCGACATAACCCGTCCTTTTACC
GATACCTGTCGCCAGCGCGATGATTGCCGATTTCAAAGAACCGGGCAACACGATAACCTGATCGTATCCG
CGCCGCCCCAAATCCCTACCGACCCGCCAACGGCGTTTCAACTCCAACGCACCATGTCCGAACGAATTCT
CAAGAATTTCATTCACTTCCGGCATACGCTCGAACACCGCCATCGACCACTTCGGTGCGAACACATCAAT
CGTGCAACCGGGGTGAAGTTCCTTCAAACGGCGGAACAAGGGCTGGGTCATCACGCAGTCGCCTATCCAA
CTGGGGGAAATAATCAGGATTTTGATGGACA
Protein Sequence
>gi|15677379|ref|NP_274534.1| ADP-heptose:LPS heptosyltransferase II [Neisseria meningitidis MC58]
MSIKILIISPSWIGDCVMTQPLFRRLKELHPGCTIDVFAPKWSMAVFERMPEVNEILENSFGHGALELKR
RWRVGRDLGRRGYDQVIVLPGSLKSAIIALATGIGKRTGYVGESRYFLLNDIRRLDKERLPLMVDRYTAL
AHPSQEDFDGHSGFPEFSIDERRREISVETFGLDIGKPVLAFCPGAEFGPAKRWPTRHFAELGKHYLAAG
WQVWLFGSQKDDEIAEEINRLSDGMCVNLCGKTDLSQAMDLLSLADTVVCNDSGLMHLAAALGRKVVAVY
GSSSPTHTPPLSDRAKIVSLHLECSPCFKRECPLGHTDCLNRLYPEKIVQAVEEAV
Molecule Role Virmugen
Molecule Role Annotation An rfaF mutant, in combination with a siaD mutation, is attenuated in mice and induces significant protection from challenge with wild type N. meningitidis (Li et al., 2004).
Related Vaccines(s) Neisseria meningitidis rfaF/siaD mutant vaccine
References