VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

metH

Gene Name metH
Sequence Strain (Species/Organism) Neisseria meningitidis MC58
NCBI Gene ID 903064
NCBI Protein GI 15676837
Locus Tag NMB0944
Genbank Accession AE002098
Protein Accession NP_273982
Taxonomy ID 122586
Gene Starting Position 957284
Gene Ending Position 959560
Gene Strand (Orientation) +
Protein Name 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase
Protein pI 5.08
Protein Weight 79718.7
Protein Length 758
Protein Note catalyzes the transfer of a methyl group from 5-methyltetrahydrofolate to homocysteine to form methionine
DNA Sequence
>gi|77358697:957284-959560 Neisseria meningitidis MC58, complete genome
CATGACAACATTACATTTCTCAGGCTTCCCGCGTGTCGGCGCCTTCCGCGAATTGAAATTCGCACAAGAA
AAATACTGGCGCAAAGAAATCAGCGAGCAAGAATTGCTGGCTGTTGCTAAAGACTTGCGCGAGAAAAACT
GGAAACACCAGGTCGCTGCCAACGCCGATTTCGTTGCCGTAGGCGATTTCACTTTCTACGACCACATCCT
CGACCTGCAAGTCGCCACCGGCGCGATTCCCGCCCGCTTCGGCTTCGACAGCCAAAACCTGTCTTTGGAA
CAATTCTTCCAACTGGCGCGCGGTAACAAAGACCAATTCGCTATCGAAATGACCAAATGGTTCGACACCA
ACTACCACTACTTGGTGCCTGAATTCCACGCCGATACCGAATTCAAAGCCAATGCCAAACACTATGTTCA
ACAACTGCAAGAAGCCCAAGCCCTCGGTCTGAAAGCCAAACCGACCGTTGTAGGTCCGTTGACTTTCCTG
TGGGTGGGTAAAGAAAAAGGCGCCGTCGAATTCGACCGTCTGAGCCTGTTGCCTAAACTGTTGCCTGTTT
ACGTTGAAATCCTGACTGCTTTGGTTGAAGCCGGTGCCGAGTGGATTCAAATCGACGAGCCTGCTTTGGC
TGTCGATTTGCCTAAAGAATGGGTGGAAGCCTACAAAGACGTTTACGCTACTTTGAGCAAAGTAAGTGCC
AAAATCCTGTTGAGCACTTACTTCGGTTCTGTTGCCGAACACGCCGCATTGTTGAAAGCCCTGCCTGTTG
ACGGTCTGCACATCGACTTGGTACGCGCCCCCGAGCAACTGGACGCGTTCGCCGACTACGACAAAGTCCT
GTCTGCCGGCGTGATTGACGGCCGCAACATTTGGCGCGCCAACCTGAACAAAGTTTTGGAAACTGTCGAG
CCTCTGCAAGCCAAACTGGGTGACCGTTTGTGGATTTCCAGCTCTTGCTCGCTGCTGCACACTCCATTTG
ACTTGTCAGTTGAAGAAAAACTGAAAGCCAACAAACCCGACCTGTACTCTTGGTTGGCATTCACCCTGCA
AAAAACCCAAGAATTGCGCGTTCTGAAAGCTGCATTGAACGAAGGCCGTGATTCTGTTGCCGAAGAACTC
GCCGCCAGCCAAGCTGCTGCCGACTCCCGTGCCAACAGCAGCGAAATCCATCGTGCAGACGTTGCCAAAC
GCCTGGCCGATTTGCCTGCCAACGCAGACCAACGCAAATCTCCATTTGCCGACCGTATCAAAGCGCAACA
AGCATGGTTGAACCTACCTCTGCTACCGACTACCAACATCGGTTCTTTCCCGCAAACCACCGAAATCCGC
CAGGCACGCTCAGCCTTCAAAAAAGGCGAACTGTCTGCCGCCGATTACGAAGCCGCGATGAAAAAAGAAA
TCGCCTTGGTGGTTGAAGAGCAAGAAAAACTGGACTTGGACGTACTGGTACACGGCGAAGCCGAGCGTAA
CGACATGGTTGAATACTTCGGCGAATTGTTGAGCGGTTTTGCATTCACTCAATACGGCTGGGTACAAAGC
TACGGCTCACGCTGCGTGAAACCACCGATTATCTTTGGCGACGTAAGCCGTCCTGAAGCCATGACCGTGG
CTTGGTCTACTTACGCACAAAGCCTGACCAAACGCCCGATGAAAGGTATGTTGACCGGCCCTGTAACCAT
TCTGCAATGGTCTTTCGTCCGCAACGACATTCCTCGCTCTACCGTGTGCAAACAAATCGCACTGGCTCTG
AACGACGAAGTATTGGATCTGGAAAAAGCCGGCATCAAAGTCATCCAAATTGACGAACCTGCCATCCGCG
AAGGCTTGCCGCTGAAACGCGCCGATTGGGATGCCTACCTGAACTGGGCGGGCGAATCCTTCCGCCTGTC
CTCTGCCGGTTGCGAAGACAGCACCCAAATCCACACTCATATGTGTTACTCCGAGTTCAACGATATCCTG
CCTGCGATTGCTGCAATGGATGCGGACGTGATCACCATCGAGACTTCACGTTCCGACATGGAACTCTTGA
CCGCGTTCGGCGAATTCCAATACCCGAACGACATCGGCCCGGGGGTTTACGACATCCACAGCCCGCGCGT
ACCGACAGAAGCCGAAGTGGAGCACCTGTTGCGCAAAGCCATCGAGGTTGTACCGGTTGAACGTCTGTGG
GTTAACCCGGACTGCGGCCTGAAAACACGCGGCTGGAAAGAAACTCTGGAACAACTCCAAGTAATGATGA
ACGTAACCCGAAAACTGCGTGCCGAATTGGCGAAATA
Protein Sequence
>gi|15676837|ref|NP_273982.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [Neisseria meningitidis MC58]
MTTLHFSGFPRVGAFRELKFAQEKYWRKEISEQELLAVAKDLREKNWKHQVAANADFVAVGDFTFYDHIL
DLQVATGAIPARFGFDSQNLSLEQFFQLARGNKDQFAIEMTKWFDTNYHYLVPEFHADTEFKANAKHYVQ
QLQEAQALGLKAKPTVVGPLTFLWVGKEKGAVEFDRLSLLPKLLPVYVEILTALVEAGAEWIQIDEPALA
VDLPKEWVEAYKDVYATLSKVSAKILLSTYFGSVAEHAALLKALPVDGLHIDLVRAPEQLDAFADYDKVL
SAGVIDGRNIWRANLNKVLETVEPLQAKLGDRLWISSSCSLLHTPFDLSVEEKLKANKPDLYSWLAFTLQ
KTQELRVLKAALNEGRDSVAEELAASQAAADSRANSSEIHRADVAKRLADLPANADQRKSPFADRIKAQQ
AWLNLPLLPTTNIGSFPQTTEIRQARSAFKKGELSAADYEAAMKKEIALVVEEQEKLDLDVLVHGEAERN
DMVEYFGELLSGFAFTQYGWVQSYGSRCVKPPIIFGDVSRPEAMTVAWSTYAQSLTKRPMKGMLTGPVTI
LQWSFVRNDIPRSTVCKQIALALNDEVLDLEKAGIKVIQIDEPAIREGLPLKRADWDAYLNWAGESFRLS
SAGCEDSTQIHTHMCYSEFNDILPAIAAMDADVITIETSRSDMELLTAFGEFQYPNDIGPGVYDIHSPRV
PTEAEVEHLLRKAIEVVPVERLWVNPDCGLKTRGWKETLEQLQVMMNVTRKLRAELAK
Molecule Role Virmugen
Molecule Role Annotation A metH mutant, in combination with a siaD mutation, is attenuated in mice and induces significant protection from challenge with wild type N. meningitidis (Li et al., 2004).
Related Vaccines(s) Neisseria meningitidis metH/siaD mutant vaccine
References