VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

leuD

Gene Name leuD
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
NCBI Gene ID 888225
NCBI Protein GI 15610124
Locus Tag Rv2987c
Genbank Accession BX842581
Protein Accession NP_217503
3D structure: PDB ID 3H5J
Taxonomy ID 83332
Gene Starting Position 3344032
Gene Ending Position 3344628
Gene Strand (Orientation) -
Protein Name isopropylmalate isomerase small subunit
Protein pI 4.89
Protein Weight 20390.6
Protein Length 198
Protein Note catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate in leucine biosynthesis; forms a heterodimer of LeuC/D
DNA Sequence
>gi|57116681:3344032-3344628 Mycobacterium tuberculosis H37Rv, complete genome
CTCAGGGGGCGGGTAGAGTGCGCGGTTTCCAGTACGCGCACGCACCCTCAAAGGCCTCGATCTCGTCGAG
TTTCCGCAGCGTAAGGGCTATATCGTCGAGACCTTCAAGCAGCCGCCACGCCGAGTGGTCGTCAATCTTG
AACGGCAGCACCACTGTTGCTGCGGTGATAATTCGATCTTGAAGATTGGCAGTGATTTCCAGGCCCGGAC
TCTGCTCAATGAGCTTCCACAGGAGTTCCACATCGTCTTGGGCAACCTCGGCCGCCAGCAGCCCGGCCTT
GCCCGCGTTGCCGCGGAAAATGTCACCAAATCGGGATGAGATAACCACCCGGAATCCGTAGTCCATGAGC
GCCCAGACCGCATGCTCTCGCGAGGATCCGGTGCCGAAATCGGGCCCGGCAACCAGGACCGAACCCCGGT
CAAAGGGACTGAGGTTTAGCACGAATGCAGGATCCGACCGCCAACCCGCGAACAAGCCGTCCTCGAAACC
GGTTCGGGTGACCCGCTTCAGAAAGACCGCGGGAATGATCTGATCGGTGTCGACATTGGACCGCCGCAAC
GGCACGCCAATACCAGAGTGGGTGTGAAAGGCTTCCA
Protein Sequence
>gi|15610124|ref|NP_217503.1| isopropylmalate isomerase small subunit [Mycobacterium tuberculosis H37Rv]
MEAFHTHSGIGVPLRRSNVDTDQIIPAVFLKRVTRTGFEDGLFAGWRSDPAFVLNLSPFDRGSVLVAGPD
FGTGSSREHAVWALMDYGFRVVISSRFGDIFRGNAGKAGLLAAEVAQDDVELLWKLIEQSPGLEITANLQ
DRIITAATVVLPFKIDDHSAWRLLEGLDDIALTLRKLDEIEAFEGACAYWKPRTLPAP
Molecule Role Virmugen
Molecule Role Annotation Deletion of leuD gene was shown to be highly attenuated. Immunocompetent BALB/c mice vaccinated with the DleuD auxotroph were protected as well as BCG in terms of survival following an intravenous or aerosol challenge with virulent M. tuberculosis (Hondalus et al., 2000).
Related Vaccines(s) Mycobacterium tuberculosis leuD mutant vaccine
References