VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

lysA

Gene Name lysA
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
NCBI Gene ID 886960
NCBI Protein GI 15608433
Locus Tag Rv1293
Genbank Accession BX842576
Protein Accession NP_215809
3D structure: PDB ID 1HKW
Taxonomy ID 83332
Gene Starting Position 1448027
Gene Ending Position 1449370
Gene Strand (Orientation) ?
Protein Name diaminopimelate decarboxylase LysA
Protein pI 5.07
Protein Weight 42101.78
Protein Length 447
Protein Note Rv1293, (MTCY373.13), len: 447 aa. Probable lysA, diaminopimelate decarboxylase (EC 4.1.1.20) (see citation below), almost identical to DCDA_MYCTU|P31848. Contains PS00878 Orn/DAP/Arg decarboxylases family 2 pyridoxal-P attachment site, PS00879 Orn/DAP/Arg decarboxylases family 2 signature 2. BELONGS TO FAMILY 2 OF ORNITHINE, DAP, AND ARGININE DECARBOXYLASES.
DNA Sequence
>gi|57116681:1448027-1449370 Mycobacterium tuberculosis H37Rv, complete genome
TGTGAACGAGCTGCTGCACTTAGCGCCGAATGTGTGGCCGCGCAATACTACTCGCGATGAAGTCGGTGTG
GTCTGCATCGCAGGAATTCCACTGACGCAGCTCGCCCAGGAGTACGGGACCCCGCTGTTCGTCATCGACG
AGGACGACTTTCGCTCGCGCTGCCGAGAAACCGCCGCGGCCTTTGGAAGTGGGGCGAACGTGCACTATGC
CGCCAAGGCGTTCCTGTGCAGCGAAGTAGCCCGGTGGATCAGCGAAGAAGGGCTCTGTCTGGACGTTTGC
ACCGGTGGGGAGTTGGCGGTCGCGCTGCACGCTAGCTTTCCGCCCGAGCGAATTACCTTGCACGGCAACA
ACAAATCGGTCTCAGAGTTGACCGCTGCGGTCAAAGCCGGAGTCGGCCATATTGTCGTCGATTCGATGAC
CGAGATCGAGCGCCTCGACGCCATCGCGGGCGAGGCCGGAATCGTCCAGGATGTCCTGGTGCGTCTCACC
GTCGGTGTCGAGGCGCACACCCACGAGTTCATCTCCACCGCGCACGAGGACCAGAAATTCGGGTTATCGG
TGGCCAGCGGCGCGGCCATGGCAGCGGTGCGGCGCGTTTTCGCCACTGATCACCTGCGCCTGGTTGGGCT
ACACAGCCACATCGGTTCGCAGATCTTCGACGTGGACGGCTTCGAACTCGCCGCGCACCGTGTCATCGGC
CTGCTACGCGACGTCGTCGGCGAGTTCGGTCCCGAAAAGACGGCACAGATCGCGACCGTCGATCTCGGTG
GCGGCTTGGGCATCTCGTATTTGCCGTCCGACGACCCACCGCCGATAGCCGAGCTCGCGGCCAAGCTGGG
TACCATCGTGAGCGACGAGTCAACGGCCGTGGGGCTGCCGACGCCCAAGCTCGTTGTGGAGCCCGGACGC
GCCATCGCCGGACCGGGCACCATCACGTTGTATGAGGTCGGCACCGTTAAGGACGTCGATGTCAGCGCCA
CAGCGCATCGACGTTACGTCAGTGTCGACGGCGGCATGAGCGACAACATCCGCACCGCGCTCTACGGCGC
GCAGTATGACGTCCGGCTGGTGTCTCGAGTCAGCGACGCCCCGCCGGTACCGGCCCGTCTGGTCGGAAAG
CACTGCGAAAGTGGCGATATCATCGTGCGGGACACCTGGGTGCCCGACGATATTCGGCCCGGCGATCTGG
TTGCGGTTGCCGCCACCGGCGCTTACTGCTATTCGCTGTCGAGTCGTTACAACATGGTCGGCCGTCCCGC
TGTGGTAGCGGTGCACGCGGGCAACGCTCGCCTGGTCCTGCGTCGGGAGACGGTCGACGATTTGCTGAGT
TTGGAAGTGAGGTG
Protein Sequence
>gi|15608433|ref|NP_215809.1| diaminopimelate decarboxylase LysA [Mycobacterium tuberculosis H37Rv]
MNELLHLAPNVWPRNTTRDEVGVVCIAGIPLTQLAQEYGTPLFVIDEDDFRSRCRETAAAFGSGANVHYA
AKAFLCSEVARWISEEGLCLDVCTGGELAVALHASFPPERITLHGNNKSVSELTAAVKAGVGHIVVDSMT
EIERLDAIAGEAGIVQDVLVRLTVGVEAHTHEFISTAHEDQKFGLSVASGAAMAAVRRVFATDHLRLVGL
HSHIGSQIFDVDGFELAAHRVIGLLRDVVGEFGPEKTAQIATVDLGGGLGISYLPSDDPPPIAELAAKLG
TIVSDESTAVGLPTPKLVVEPGRAIAGPGTITLYEVGTVKDVDVSATAHRRYVSVDGGMSDNIRTALYGA
QYDVRLVSRVSDAPPVPARLVGKHCESGDIIVRDTWVPDDIRPGDLVAVAATGAYCYSLSSRYNMVGRPA
VVAVHAGNARLVLRRETVDDLLSLEVR
Molecule Role Virmugen
Molecule Role Annotation A lysA mutant, in combination with a secA2 mutation, is highly attenuated in mice and induced significant protection from challenge with wild type M. tuberculosis (Hinchey et al., 2011).
Related Vaccines(s) Mycobacterium tuberculosis lysA/secA2 mutant vaccine
References