VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign2
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

carA

Gene Name carA
Sequence Strain (Species/Organism) Escherichia coli str. K-12 substr. MG1655
NCBI Gene ID 949025
NCBI Protein GI 16128026
Locus Tag b0032
Genbank Accession U00096
Protein Accession NP_414573
3D structure: PDB ID 1Q15
Taxonomy ID 511145
Gene Starting Position 29650
Gene Ending Position 30798
Gene Strand (Orientation) +
Protein Name carbamoyl phosphate synthetase small subunit, glutamine amidotransferase
Protein pI 6.34
Protein Weight 39148.3
Protein Length 382
Protein Note Also known as arg; cap; ECK0033; JW0030; pyrA6.3.5.5
DNA Sequence
>gi|49175990:29650-30798 Escherichia coli str. K-12 substr. MG1655 chromosome, complete genome
TTTGATTAAGTCAGCGCTATTGGTTCTGGAAGACGGAACCCAGTTTCACGGTCGGGCCATAGGGGCAACA
GGTTCGGCGGTTGGGGAAGTCGTTTTCAATACTTCAATGACCGGTTATCAAGAAATCCTCACTGATCCTT
CCTATTCTCGTCAAATCGTTACTCTTACTTATCCCCATATTGGCAATGTCGGCACCAATGACGCCGATGA
AGAATCTTCTCAGGTACATGCACAAGGTCTGGTGATTCGCGACCTGCCGCTGATTGCCAGCAACTTCCGT
AATACCGAAGACCTCTCTTCTTACCTGAAACGCCATAACATCGTGGCGATTGCCGATATCGATACCCGTA
AGCTGACGCGTTTACTGCGCGAGAAAGGCGCACAGAATGGCTGCATTATCGCGGGCGATAACCCGGATGC
GGCGCTGGCGTTAGAAAAAGCCCGCGCGTTCCCAGGTCTGAATGGCATGGATCTGGCAAAAGAAGTGACC
ACCGCAGAAGCCTATAGCTGGACACAAGGGAGCTGGACGTTGACCGGTGGCCTGCCAGAAGCGAAAAAAG
AAGACGAGCTGCCGTTCCACGTCGTGGCTTATGATTTTGGTGCCAAGCGCAACATCCTGCGGATGCTGGT
GGATAGAGGCTGTCGCCTGACCATCGTTCCGGCGCAAACTTCTGCGGAAGATGTGCTGAAAATGAATCCA
GACGGCATCTTCCTCTCCAACGGTCCTGGCGACCCGGCCCCGTGCGATTACGCCATTACCGCCATCCAGA
AATTCCTCGAAACCGATATTCCGGTATTCGGCATCTGTCTCGGTCATCAGCTGCTGGCGCTGGCGAGCGG
TGCGAAGACTGTCAAAATGAAATTTGGTCACCACGGCGGCAACCATCCGGTTAAAGATGTGGAGAAAAAC
GTGGTAATGATCACCGCCCAGAACCACGGTTTTGCGGTGGACGAAGCAACATTACCTGCAAACCTGCGTG
TCACGCATAAATCCCTGTTCGACGGTACGTTACAGGGCATTCATCGCACCGATAAACCGGCATTCAGCTT
CCAGGGGCACCCTGAAGCCAGCCCTGGTCCACACGACGCCGCGCCGTTGTTCGACCACTTTATCGAGTTA
ATTGAGCAGTACCGTAAAACCGCTAAGTA
Protein Sequence
>gi|16128026|ref|NP_414573.1| carbamoyl phosphate synthetase small subunit, glutamine amidotransferase [Escherichia coli str. K-12 substr. MG1655]
MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADE
ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDA
ALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLV
DRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASG
AKTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSF
QGHPEASPGPHDAAPLFDHFIELIEQYRKTAK
Molecule Role Virmugen
Molecule Role Annotation A carAB mutant is attenuated in turkeys and induces significant protection from challenge with wild type E. coli (Kwaga et al., 1994).
Related Vaccines(s) Escherichia coli carAB mutant vaccine
References