VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

pgk

Gene Name pgk
Sequence Strain (Species/Organism) Brucella melitensis biovar Abortus 2308
NCBI Gene ID 3788256
NCBI Protein GI 82700518
Locus Tag BAB1_1742
Genbank Accession AM040264
Protein Accession YP_415092
Taxonomy ID 359391
Chromosome No I
Gene Starting Position 1682955
Gene Ending Position 1684142
Gene Strand (Orientation) ?
Protein Name phosphoglycerate kinase
Protein pI 5.91
Protein Weight 37696.73
Protein Length 395
Protein Note Converts 3-phospho-D-glycerate to 3-phospho-D-glyceroyl phosphate during the glycolysis pathway
DNA Sequence
>gi|82698932:1682955-1684142 Brucella melitensis biovar Abortus 2308 chromosome chromosome I, complete sequence
GATGTTCCGCACCCTTGACGATGCCAATGTCCAATCCAAGCGCGTGCTGGTCCGTGTTGACCTCAACGTG
CCGATGGCAAACGGCGAAGTCACCGACCTTACCCGCATCGAACGCATCGTTCCGACCATCGCGGAACTGT
CAAGGAAGGGCGCGAAGGTCATCCTGCTCGCCCATTTCGGTCGCCCGAAGGGGGTTGCCTCGGATGAAAA
TTCGCTGAAGCATGTCGTGAAGCCGCTCTCCAAGGTTCTGGATCACAGTGTTCATTTTGCCGAAGACTGC
ATCGGCGACAAGGCGAAAGCGGCCGTCGATGCGCTGAAGGACGGCGACGTCCTGCTTCTGGAAAATACCC
GTTTCCACAAGGGCGAGGAAAAGAACGATCCTGAATTCGTGCAGGCGCTGGCCGCCAATGGCGATCTCTA
TGTGAACGATGCCTTTTCCGCCGCTCACCGCGCCCATGCCTCGACTGAAGGTCTGGCCCATGTCCTGCCT
GCCTTCGCGGGCCGCGCCATGCAGGCTGAGCTTGAAGCACTTGAAAAGGGCCTCGGCAATCCGGCCCGCC
CGGTGGTCGCCATCGTCGGCGGTGCAAAGGTTTCGACCAAGCTCGACCTCCTGTCCAACCTGATCGAAAA
GGTCGATGCGCTTGTCATCGGCGGCGGCATGGCCAACACGTTCCTTGCAGCCAAGGGTCTTGATGTCGGC
AAATCGCTCTGCGAGCATGAGCTGGCCTCGACCGCACGCGAAATCATGGCCAAGGCCGAAACCACCAAAT
GCGCCATCATCCTGCCGGTGGACGCGGTCGTGGGCTGGCACTTCGCCGCCGATACGCCACACCAGACCTA
TGGCGTGGATTCGGTTCCGGGCGACGCCATGATCCTTGACGCAGGCGAGCTTTCGACCGACCTCATTGCT
TCGGCCATCGATGATGCCGCAACATTGGTCTGGAACGGCCCGCTTGGGGCTTTCGAGTTGCGCCCCTTTG
ACACAGCAACGGTGAAGGTCGCAAGGCATGTCGCAAAGCGCACAAAGGAAGGCAAGCTTGTTTCGGTCGG
CGGCGGCGGCGATACGGTGGCAGCCCTCAACCATGCGGGCGTGGCCGACGACTTCACCTATATCTCAACC
GCTGGCGGCGCTTTCCTCGAATGGATGGAAGGCAAACCGCTTCCGGGCGTCGATGTATTGAAGAAGTG
Protein Sequence
>gi|82700518|ref|YP_415092.1| phosphoglycerate kinase [Brucella melitensis biovar Abortus 2308]
MFRTLDDANVQSKRVLVRVDLNVPMANGEVTDLTRIERIVPTIAELSRKGAKVILLAHFGRPKGVASDEN
SLKHVVKPLSKVLDHSVHFAEDCIGDKAKAAVDALKDGDVLLLENTRFHKGEEKNDPEFVQALAANGDLY
VNDAFSAAHRAHASTEGLAHVLPAFAGRAMQAELEALEKGLGNPARPVVAIVGGAKVSTKLDLLSNLIEK
VDALVIGGGMANTFLAAKGLDVGKSLCEHELASTAREIMAKAETTKCAIILPVDAVVGWHFAADTPHQTY
GVDSVPGDAMILDAGELSTDLIASAIDDAATLVWNGPLGAFELRPFDTATVKVARHVAKRTKEGKLVSVG
GGGDTVAALNHAGVADDFTYISTAGGAFLEWMEGKPLPGVDVLKK
Molecule Role Virmugen
Molecule Role Annotation A pgk mutant is attenuated in mice and induces significant protection from challenge with wild type B. abortus (Trant et al., 2010).
Related Vaccines(s) Brucella abortus pgk mutant vaccine
References