VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

asd

Gene Name asd
Sequence Strain (Species/Organism) Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
NCBI Protein GI 267995764
Other Database IDs CDD:180636
CDD:189205
CDD:145758
Taxonomy ID 588858
Gene Strand (Orientation) ?
Protein Name aspartate-semialdehyde dehydrogenase
Protein Length 368
Protein Note aspartate-semialdehyde dehydrogenase; Reviewed
Protein Sequence
>gi|267995764|gb|ACY90649.1| aspartate-semialdehyde dehydrogenase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
MKNVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQFGQAAPTFGDTSTGTLQDAFDLDALKALDII
VTCQGGDYTNEIYPKLRESGWQGYWIDAASTLRMKDDAIIILDPVNQDVITDGLNNGVKTFVGGNCTVSL
MLMSLGGLFAHNLVDWVSVATYQAASGGGARHMRELLTQMGQLYGHVADELATPSSAILDIERKVTALTR
SGELPVDNFGVPLAGSLIPWIDKQLDNGQSREEWKGQAETNKILNTASVIPVDGLCVRVGALRCHSQAFT
IKLKKEVSIPTVEELLAAHNPWAKVVPNDRDITMRELTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGD
QLLWGAAEPLRRMLRQLA
Molecule Role Virmugen
Molecule Role Annotation An asd mutant, alone or in combination with a rfc mutation, is attenuated in mice and induces significant protection from challenge with wild type Salmonella typhimurium (Piao et al., 2010).
Related Vaccines(s) Salmonella Typhimurium asd mutant vaccine , Salmonella Typhimurium asd/rfc mutant vaccine
References