VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

rfc

Gene Name rfc
Sequence Strain (Species/Organism) Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
NCBI Protein GI 267993210
Other Database IDs CDD:33116
CDD:186638
Taxonomy ID 588858
Gene Strand (Orientation) ?
Protein Name O-antigen polymerase
Protein Length 407
Protein Note O-antigen polymerase (SW:RFC_SALTY)
Protein Sequence
>gi|267993210|gb|ACY88095.1| O-antigen polymerase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
MLIISYIALCLLFIVYLYTLSVRIEGKIINVMVPYLIITVPTLYVFEGIFVYLSEVQNYTVEYLFFYTCY
ITYIASFVISYLYTQRKPIYNKSNTKNKPRYVFTSLLFTFLAFIIYLPVLMEFREYILSPRRIYELTRTG
YGIYFYPSLMFSLVASICAFFTYKKSKLFCISIVLFNCILIFLHGNKGPIFSIFIAFILYLSYIENKKIK
FMFLVKSFAVIAVIVTAFFAYTFTDGNPIENMANYSDYTRNAVLVASSNFDFMYGKLLMESEVYSRIPRA
IWPDKPEDFGALYLAKVFFPDAFYRNQGAPAFGYGELYADFGLFTPVWLVISGVFKGVLAKYFSNKTQET
KSAHYFIMFLFCIGISVIPVSMGWLFPEHLMIAFMVYIASSFVFSEHIRFVLLRNNK
Molecule Role Virmugen
Molecule Role Annotation An rfc mutant, in combination with an asd mutation, is attenuated in mice and induces significant protection from challenge with wild type S. typhimurium (Piao et al., 2010).
Related Vaccines(s) Salmonella Typhimurium asd/rfc mutant vaccine
References