VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

cpxR

Gene Name cpxR
Sequence Strain (Species/Organism) Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91
NCBI Gene ID 6923307
NCBI Protein GI 205354363
Locus Tag SG3362
Genbank Accession AM933173
Protein Accession YP_002228164
Taxonomy ID 550538
Gene Starting Position 3515980
Gene Ending Position 3516678
Gene Strand (Orientation) ?
Protein Name DNA-binding transcriptional regulator CpxR
Protein pI 5.38
Protein Weight 25082.91
Protein Length 232
Protein Note response regulator in two-component regulatory system with CpxA; part of the envelope stress response system
DNA Sequence
>gi|205351346:3515980-3516678 Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 chromosome, complete genome
AATGAATAAAATCCTGTTAGTTGATGATGACCGAGAGCTGACTTCCCTGTTAAAAGAGCTCCTCGAAATG
GAAGGTTTTAATGTCCTGGTGGCCCACGACGGCGAGCAGGCGCTTGAGCTTTTGGATGACAGCATCGATT
TACTTTTGCTTGACGTCATGATGCCGAAGAAAAACGGTATCGATACGTTGAAAGCGCTTCGCCAGACACA
CCAGACGCCTGTCATTATGCTGACCGCGCGCGGCAGCGAGCTGGATCGCGTTCTCGGCCTTGAGCTGGGC
GCGGACGACTATTTGCCCAAACCGTTTAACGACCGCGAGCTGGTAGCGCGCATCAGGGCTATTTTGCGCC
GTTCCCACTGGAGCGAACAGCAGCAGAGCAGCGACAACGGCTCGCCGACGCTGGAAGTCGATGCGCTAAG
CCTTAATCCGGGTCGCCAGGAAGCCAGTTTCGATGGCCAAACGCTGGAGCTGACCGGTACGGAATTCACC
CTGCTCTATTTGCTGGCGCAACACCTCGGCCAGGTGGTTTCCCGTGAACATTTAAGCCAGGAAGTGCTGG
GTAAGCGCCTGACGCCGTTCGATCGCGCCATTGATATGCATATTTCTAACCTGCGCCGCAAACTGCCGGA
ACGCAAAGACGGTCACCCGTGGTTTAAAACATTGCGTGGTCGCGGCTATCTGATGGTTTCCGCTTCATG
Protein Sequence
>gi|205354363|ref|YP_002228164.1| DNA-binding transcriptional regulator CpxR [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
MNKILLVDDDRELTSLLKELLEMEGFNVLVAHDGEQALELLDDSIDLLLLDVMMPKKNGIDTLKALRQTH
QTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSHWSEQQQSSDNGSPTLEVDALS
LNPGRQEASFDGQTLELTGTEFTLLYLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPE
RKDGHPWFKTLRGRGYLMVSAS
Molecule Role Virmugen
Molecule Role Annotation A cpxR mutant, in combination with a lon mutation, is highly attenuated in mice and induces significant protection from challenge with wild type S. gallinarum (Matsuda et al., 2010).
Related Vaccines(s) Salmonella Gallinarum cpxR/Ion mutant vaccine
References