VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

lon

Gene Name lon
Sequence Strain (Species/Organism) Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91
NCBI Gene ID 6923289
NCBI Protein GI 205351761
Locus Tag SG0461
Genbank Accession AM933173
Protein Accession YP_002225562
Taxonomy ID 550538
Gene Starting Position 503376
Gene Ending Position 505730
Gene Strand (Orientation) ?
Protein Name DNA-binding ATP-dependent protease La
Protein pI 6.32
Protein Weight 81259.62
Protein Length 784
DNA Sequence
>gi|205351346:503376-505730 Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 chromosome, complete genome
TATGAATCCTGAGCGTTCTGAACGCATTGAAATCCCCGTATTGCCCTTGCGCGATGTGGTGGTTTATCCG
CACATGGTCATACCCTTATTTGTAGGGCGGGAGAAATCTATCCGTTGTCTGGAAGCGGCTATGGACCATG
ATAAAAAAATCATGCTGGTCGCCCAGAAGGAAGCATCGACGGATGAGCCGGGTGTAAACGATCTTTTCAC
CGTCGGGACCGTGGCCTCTATTTTGCAGATGCTGAAACTGCCTGACGGCACCGTAAAAGTGCTGGTCGAG
GGGTTACAGCGCGCGCGTATTTCCGCGCTGTCTGACAACGGCGAACATTTCTCCGCGAAGGCGGAGTACC
TTGATTCGCCAGCCATTGATGAGCGTGAACAAGAAGTGCTGGTGCGTACCGCTATCAGCCAGTTCGAAGG
CTACATCAAGCTGAACAAAAAAATTCCGCCGGAAGTGCTGACGTCACTCAATAGCATTGACGACCCTGCA
CGTCTGGCTGACACCATCGCCGCGCATATGCCGCTGAAACTGGCGGATAAACAGTCCGTACTGGAGATGT
CCGACGTTAACGAACGTCTGGAATATCTGATGGCGATGATGGAATCTGAAATCGATCTGCTGCAGGTTGA
GAAACGCATTCGCAACCGCGTGAAAAAGCAGATGGAGAAATCCCAGCGCGAGTACTATCTGAACGAGCAA
ATGAAAGCGATTCAGAAAGAGCTTGGAGAGATGGACGACGCGCCGGACGAAAACGAAGCGCTGAAGCGTA
AGATCGACGCGGCGAAAATGCCGAAAGAGGCGAAAGAGAAAGCGGAAGCGGAACTGCAGAAGCTGAAAAT
GATGTCTCCGATGTCGGCGGAAGCGACCGTGGTGCGCGGCTACATCGACTGGATGGTGCAGGTGCCGTGG
AATGCGCGTAGCAAGGTCAAAAAAGACCTGCGTCAGGCGCAGGAAATCCTCGATACTGACCATTATGGTC
TGGAGCGCGTGAAAGACCGCATCCTTGAGTATCTCGCGGTTCAAAGCCGTGTAAATAAAATCAAGGGGCC
GATCCTGTGTCTGGTGGGGCCGCCGGGGGTAGGTAAAACCTCGTTGGGCCAGTCCATCGCTAAAGCAACA
GGGCGTAAATACATCCGTATGGCGCTGGGCGGCGTGCGTGATGAAGCGGAAATCCGCGGTCATCGCCGGA
CTTACATTGGCTCTATGCCGGGTAAACTGATCCAAAAAATGGCCAAAGTGGGGGTTAAAAACCCACTGTT
CCTGCTCGATGAGATCGACAAAATGTCTTCTGACATGCGCGGCGATCCGGCTTCCGCACTGCTGGAAGTG
CTGGATCCGGAGCAGAACGTGGCGTTCAGCGATCATTACCTGGAAGTGGATTACGATCTCAGCGATGTGA
TGTTCGTCGCCACTTCCAACTCCATGAACATTCCGGCGCCGCTGCTGGATCGTATGGAAGTGATCCGTCT
GTCCGGTTATACCGAAGACGAGAAGCTGAATATTGCTAAACGTCACCTGCTGCCGAAGCAGATCGAGCGT
AACGCGCTGAAGAAAGGCGAACTGACGGTCGACGATAGCGCGATTATCGGTATTATCCGCTATTACACGC
GTGAAGCGGGCGTTCGTAGTCTGGAGCGTGAAATCTCCAAACTGTGCCGCAAAGCGGTTAAACAACTGTT
GCTCGATAAGTCGTTAAAACATATCGAAATTAACGGTGATAATCTGCACGACTACCTCGGTGTGCAGCGC
TTTGACTATGGCCGCGCGGATAGCGAAAACCGCGTAGGTCAGGTGACGGGCCTGGCGTGGACGGAAGTGG
GCGGCGATCTGTTGACCATCGAAACCGCCTGCGTCCCGGGCAAAGGCAAGTTGACCTACACCGGCTCGCT
CGGTGAAGTGATGCAGGAATCCATTCAGGCGGCGCTGACCGTGGTGCGTGCGCGCGCGGAAAAACTGGGT
ATTAATCCGGACTTTTACGAAAAACGCGATATCCACGTTCACGTGCCGGAAGGCGCAACGCCGAAAGACG
GTCCAAGCGCCGGTATCGCGATGTGTACCGCGCTGGTTTCCTGCCTGACCGGTAATCCGGTGCGCGCAGA
TGTGGCAATGACCGGTGAGATCACGCTGCGTGGTCAGGTGTTGCCGATCGGCGGCCTGAAAGAAAAACTG
TTGGCGGCGCATCGCGGCGGGATTAAAACGGTCTTAATTCCGTTCGAAAATAAACGTGACCTGGAGGAAA
TTCCGGACAACGTGATTGCCGATCTGGATATTCATCCTGTGAAGCGCATTGAGGAAGTTCTGACGCTTGC
TCTGCAAAACGAACCGTCTGGAATGCAGGTTGTAACCGCAAAATA
Protein Sequence
>gi|205351761|ref|YP_002225562.1| DNA-binding ATP-dependent protease La [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
MNPERSERIEIPVLPLRDVVVYPHMVIPLFVGREKSIRCLEAAMDHDKKIMLVAQKEASTDEPGVNDLFT
VGTVASILQMLKLPDGTVKVLVEGLQRARISALSDNGEHFSAKAEYLDSPAIDEREQEVLVRTAISQFEG
YIKLNKKIPPEVLTSLNSIDDPARLADTIAAHMPLKLADKQSVLEMSDVNERLEYLMAMMESEIDLLQVE
KRIRNRVKKQMEKSQREYYLNEQMKAIQKELGEMDDAPDENEALKRKIDAAKMPKEAKEKAEAELQKLKM
MSPMSAEATVVRGYIDWMVQVPWNARSKVKKDLRQAQEILDTDHYGLERVKDRILEYLAVQSRVNKIKGP
ILCLVGPPGVGKTSLGQSIAKATGRKYIRMALGGVRDEAEIRGHRRTYIGSMPGKLIQKMAKVGVKNPLF
LLDEIDKMSSDMRGDPASALLEVLDPEQNVAFSDHYLEVDYDLSDVMFVATSNSMNIPAPLLDRMEVIRL
SGYTEDEKLNIAKRHLLPKQIERNALKKGELTVDDSAIIGIIRYYTREAGVRSLEREISKLCRKAVKQLL
LDKSLKHIEINGDNLHDYLGVQRFDYGRADSENRVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSL
GEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPSAGIAMCTALVSCLTGNPVRAD
VAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLA
LQNEPSGMQVVTAK
Molecule Role Virmugen
Molecule Role Annotation A lon mutant, in combination with a cpxR mutation, is highly attenuated in mice and induces significant protection from challenge with wild type S. gallinarum (Matsuda et al., 2010).
Related Vaccines(s) Salmonella Gallinarum cpxR/Ion mutant vaccine
References