VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

smpB

Gene Name smpB
Sequence Strain (Species/Organism) Yersinia pestis CO92
NCBI Gene ID 1173949
NCBI Protein GI 218928269
Locus Tag YPO1101
Genbank Accession AL590842
Protein Accession YP_002346144
Taxonomy ID 214092
Gene Starting Position 1245999
Gene Ending Position 1246481
Gene Strand (Orientation) -
Protein Name SsrA-binding protein
Protein pI 10.62
Protein Weight 17315.72
Protein Length 160
Protein Note Also known as smqBbinds to ssrA RNA (tmRNA) and is required for its successful binding to ribosomes; also appears to function in the trans-translation step by promoting accommodation of tmRNA into the ribosomal A site; SmpB protects the tmRNA from RNase R degradation in Caulobacter crescentus; both the tmRNA and SmpB are regulated in cell cycle-dependent manner; functions in release of stalled ribosomes from damaged mRNAs and targeting proteins for degradation
DNA Sequence
>gi|16120353:1245999-1246481 Yersinia pestis CO92 chromosome, complete genome
CTTAACGATTTGCGTGCTTCATGATGCGCGCTTTGTCTAACTTCCACTCACGATCTCTAATATCATCGCG
CTTGTCGTTATCTTTTTTACCTTTTGCTACGCCGATTTTAACTTTCACCCAGGCATTTTTCCAATACATG
GAGAGAGCGACAACCGTGTAGCCTTCTCGGTTCACTCGGCCAAACAAGGAATCCAGTTCGCGTTTGTTCA
ACAGCAGTTTACGGGTACGCATAGGCTCGCAAACAACATGAGTCGACGCAACGTTCAACGGCGTAATTGT
GGCCCCAAACAGGAATGCCTCACCGTTTTTAAACATTACGTAGCTGTCACTGATATTTGCTTTGCCTGCA
CGCAGTGATTTTACTTCCCAACCTTGCAGTGCAAGCCCAGCTTCGAACTCTTCTTCAATGAAGTATTCGT
GACGGGCTCGTTTATTTTGCGCAATGGTTGCGGAACCGGGTTTGTATGCTTTTTTCTTTGTCA
Protein Sequence
>gi|218928269|ref|YP_002346144.1| SsrA-binding protein [Yersinia pestis CO92]
MTKKKAYKPGSATIAQNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVMFKNGEAFLFGATI
TPLNVASTHVVCEPMRTRKLLLNKRELDSLFGRVNREGYTVVALSMYWKNAWVKVKIGVAKGKKDNDKRD
DIRDREWKLDKARIMKHANR
Molecule Role Virmugen
Molecule Role Annotation An smpB mutant, in combination with an ssrA mutation, is attenuated in mice and induces significant protection from challenge with wild type Y. pestis (Okan et al., 2010).
Related Vaccines(s) Yersinia pestis smpB/ssrA mutant vaccine
References