VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

pgm

Gene Name pgm
Sequence Strain (Species/Organism) Brucella melitensis biovar Abortus 2308
NCBI Gene ID 3788847
NCBI Protein GI 82698981
Locus Tag BAB1_0055
Genbank Accession AM040264
Protein Accession YP_413555
Taxonomy ID 359391
Chromosome No I
Gene Starting Position 60852
Gene Ending Position 62483
Gene Strand (Orientation) -
Protein Name phosphoglucomutase
Protein pI 6.52
Protein Weight 55523.82
Protein Length 543
Protein Note catalyzes the interconversion of alpha-D-glucose 1-phosphate to alpha-D-glucose 6-phosphate
DNA Sequence
>gi|82698932:60852-62483 Brucella melitensis biovar Abortus 2308 chromosome chromosome I, complete sequence
CTCAAGTAACCACCGACGGCTCTGTCCGCCCGCTGCGTTTTTTTACTTCGGCGATCTGTTCAGCCGCGTC
GATCAGTGGGGCCAGCGTTGCCTGCGTGTCGAGATTATGTTTTGCAGGATCGGCTTCATAGCGTTCGATA
TAGATGCGGATGGTCGCGCCTGACGTCCCGGTACCGGACAGGCGAAGCACGATGCGCGCACCTCCTTCAA
AATAGATGCGGATGCCCTGATGTTCGCTGGTCGAGCCATCAACGGGATCATGATAGGCGAAGTCGTCGGC
CTTTTCGATCCTGAGGCCATTGACGCTCGTGCCGGGCAGGCCGGCAAGCTTGCCGCGCAGGTCAGCCACC
AGCTTCGTCGCAATATCGGAATCGACGGCTTCATAGTCGTGGCGAGTGTAATAATTGCGCCCGAAACGTG
CCCAATGGTCGTCCGCGATTGCCTTCACACTTTCCTTGCGCACCGCCAGAATGTTGAGCCAGAGCAGAAC
GGCCCACAAACCATCTTTTTCGCGCACATGGTCGGAGCCGGTGCCGGAGCTTTCCTCGCCGCAGATCGTC
ACCTTGCCGCTGTCGAGAAGATTGCCGAAGAATTTCCAGCCGGTCGGGGTTTCATACATGCCGATACCGA
GTTTTTCCGCCACGCGGTCGGCGGCGGCGCTCGTCGGCATGGAACGGGCAATGCCCTTGATACCGCCTTT
ATAGCCCGGCGCCAGATGGGCATTTGCGGCCAGCATGGCAAGCGAATCTGACGGCGTGATGAAGATACCG
CGCCCGAGAATGAGGTTGCGATCGCCATCGCCGTCGGAGGCGGCGCCAAAATCCGGCGCATGGCTGGACA
TCAGAAGATCGTAGAGATCCTTGGCATAGACGAGGTTTGGATCCGGGTGATGGCCACCGAAATCCGGCAG
GGGCACGAAATTGACGACGCTGCCTTCGGGCGCACCGAGGCGGCGCTCGAAGATTTCCTTGGCATAAGGC
CCGGTCACCGCATGCATGGCGTCGAACTTCATCTGGAAGCCGCCTTTTATCATGGCGCGGATGGCGGCGA
AATCGAACAGGCTTTCCATCAATTCAGCATAATCGGCCACCGGATCGAAGATGACCACCTCGGTATCGCC
GATCTTGCTTGTGCCGATCTTGTCGATATCGATATCGGCTGCATCTGCAATTTTATACTGGTCGATCACC
TTTGAGCGGGCGAAGATCGCTTCGGTGATCTTTTCGGGTGCCGGTCCACCATTGCCGATATTGTACTTGA
TGCCGAAATCCTGCGTAGGCCCGCCCGGATTGTGGCTGGCCGAAAGGATCATGCCACCGAAGGCTTTGTA
CTTGCGGATCATGTTGGAGGCGGCTGGCGTGGAAAGAATGCCGCCCTGTCCCACCATGATACGGCCAAAA
CCGTTGGCGGCTGCGATCTTGATAAGCTTCTGGATCACCTCGCGGTTATAAAAGCGTCCGTCGCCGCCAA
CCACGAGCGTCTTGCCCTTGAACCCCTCCAGCACGTCGAAGATCGACTGGATGAAATTTTCTGCATAATT
GGGCTGCTGGAAAACCGGAACCTTCTTGCGCAAGCCCGAAGTGCCCGGCTGTTGATCCTGGTATGGCGTG
GTCGCAATGGTCTTGACGGTCA
Protein Sequence
>gi|82698981|ref|YP_413555.1| phosphoglucomutase [Brucella melitensis biovar Abortus 2308]
MTVKTIATTPYQDQQPGTSGLRKKVPVFQQPNYAENFIQSIFDVLEGFKGKTLVVGGDGRFYNREVIQKL
IKIAAANGFGRIMVGQGGILSTPAASNMIRKYKAFGGMILSASHNPGGPTQDFGIKYNIGNGGPAPEKIT
EAIFARSKVIDQYKIADAADIDIDKIGTSKIGDTEVVIFDPVADYAELMESLFDFAAIRAMIKGGFQMKF
DAMHAVTGPYAKEIFERRLGAPEGSVVNFVPLPDFGGHHPDPNLVYAKDLYDLLMSSHAPDFGAASDGDG
DRNLILGRGIFITPSDSLAMLAANAHLAPGYKGGIKGIARSMPTSAAADRVAEKLGIGMYETPTGWKFFG
NLLDSGKVTICGEESSGTGSDHVREKDGLWAVLLWLNILAVRKESVKAIADDHWARFGRNYYTRHDYEAV
DSDIATKLVADLRGKLAGLPGTSVNGLRIEKADDFAYHDPVDGSTSEHQGIRIYFEGGARIVLRLSGTGT
SGATIRIYIERYEADPAKHNLDTQATLAPLIDAAEQIAEVKKRSGRTEPSVVT
Molecule Role Virmugen
Molecule Role Annotation A pgm mutant is attenuated in mice and induces significant protection from challenge with wild type B. abortus (Ugalde et al., 2003).
Related Vaccines(s) Brucella abortus pgm mutant vaccine
References