VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

IpxM

Gene Name IpxM
Sequence Strain (Species/Organism) Yersinia pestis CO92
NCBI Gene ID 1174901
NCBI Protein GI 218929170
Locus Tag YPO2063
Genbank Accession AL590842
Protein Accession YP_002347045
Taxonomy ID 214092
Gene Starting Position 2341683
Gene Ending Position 2342645
Gene Strand (Orientation) +
Protein Name lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA acyltransferase
Protein pI 8.71
Protein Weight 35499.74
Protein Length 320
Protein Note Transfers myristate or laurate, activated on ACP, to the lipid IVA moiety of (KDO)2-(lauroyl)-lipid IVA
DNA Sequence
>gi|16120353:2341683-2342645 Yersinia pestis CO92 chromosome, complete genome
CATGCACAAAGAAAAAAATGACGCAACTGGTTTTATTCCGGTATTTCAGAAAACCTTCCTCCATCCGCGT
TTCTGGGGGGTTTGGTTAGGTGCTGGAGCGATTGCGGCGCTCGCTTATATTCCACCCAAATTCCGTGATC
CTTTATTAGCTGGCATAGGGCGTCTCGCTGGGAAATTTGCTAAAAGCGCCCGTCGTCGCGCTCGTATTAA
TCTTCTTTATTGTATGCCTGAGTTACCCGAGTCTGAACGCGAACACATTATTGACCAGATGTTTGCTACC
GCAGCTCAACCGTTAATGATGATGGCAGAACTTTGTTTTCGTGATCCGAAAAAAGTGCTGACTCGCGTGC
ACTGGCATGGACAGGAAATACTGGATGAGCTGCAACAACAAGAGCGTAATGTTATTTTGTTGGTCCCCCA
TGCCTGGTCCATTGATATTCCGGCTATGCTGCTAGCGGAGCAGGGCAAGCCAGTTGCAGGTATGTTCCAT
CATCAACGTAATCCATTGGTGGACTATCTATGGAACAGTGCGCGTTTACATTTCGGTGGTCGGATCCATG
CCCGCGAAAGTGGCATCAAACCTTTTATCAGTTCAGTACGCCAAGGATTCTGGGGTTACTACTTACCTGA
TGAAGATTATGGTCCTGAGCAAAGTGAATTTGTTGATTTCTTCGCGACCTATAAGGCGACATTACCGGCA
ATAGGCCGTTTAATGAAAGTCTGCCGTGCGGCCATTGTACCGATGTTCCCTGTTTATAATTATAGAGAGC
ATCGTCTTGATATCTATATCCGTCCGCCAATGGATGATTTGGCGGATGCTGATGACGCCTATATTGCCCG
CCGGATGAATGAGGAAGTGGAGTTGTTGGTTAAGCCGAATCCAGAGCAATATACATGGATCTTAAAGCTG
TTAAAAACCCGGAAAGAGGGTGAAACCGAGCCCTATGTGCGCAAAGATCTTTA
Protein Sequence
>gi|218929170|ref|YP_002347045.1| lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA acyltransferase [Yersinia pestis CO92]
MHKEKNDATGFIPVFQKTFLHPRFWGVWLGAGAIAALAYIPPKFRDPLLAGIGRLAGKFAKSARRRARIN
LLYCMPELPESEREHIIDQMFATAAQPLMMMAELCFRDPKKVLTRVHWHGQEILDELQQQERNVILLVPH
AWSIDIPAMLLAEQGKPVAGMFHHQRNPLVDYLWNSARLHFGGRIHARESGIKPFISSVRQGFWGYYLPD
EDYGPEQSEFVDFFATYKATLPAIGRLMKVCRAAIVPMFPVYNYREHRLDIYIRPPMDDLADADDAYIAR
RMNEEVELLVKPNPEQYTWILKLLKTRKEGETEPYVRKDL
Molecule Role Virmugen
Molecule Role Annotation An IpxM mutant is attenuated in mice and guinea pigs. This mutant also conferred modest protection from challenge with wild type Y. pestis in Balb/c mice and significant protection in guinea pigs and outbred mice (Feodorova et al., 2007).
Related Vaccines(s) Yersinia pestis IpxM mutant vaccine
References