VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

mce-2

Gene Name mce-2
Sequence Strain (Species/Organism) Mycobacterium tuberculosis CDC1551
NCBI Gene ID 925014
NCBI Protein GI 15839991
Locus Tag MT0618
Genbank Accession AE000516
Protein Accession NP_335028
Taxonomy ID 83331
Gene Starting Position 688269
Gene Ending Position 689483
Gene Strand (Orientation) +
Protein Name virulence factor
Protein pI 4.96
Protein Weight 39757.76
Protein Length 404
Protein Note identified by similarity to GP:5814111; match to protein family HMM PF02470; match to protein family HMM TIGR00996
DNA Sequence
>gi|50953765:688269-689483 Mycobacterium tuberculosis CDC1551, complete genome
GGTGCCAACGCTGGTGACGAGGAAGAACCGACGTGCGTGGCTGTATGTGGAGGGTGTTGTCCTGCTGTTG
GTGGGCGCGTTGGTGCTCGTATTGGTGTACAAGCAGTTTCGTGGGGAATTCACGCCGAAGACCGAGCTGA
CTATGGTCGCCTCCCGGGCTGGGCTGGTTATGGAAGCTGGATCCAAAGTCACCTACAACGGGGTGGAGAT
CGGCCGGGTGGGCAGCATTTCGGAGATTGAGCGTGACGGCCGGCCGGCGGCGAAGCTGGTTTTGGACGTG
AATCCTCGCTACATCAGCCTGATTCCGGTCAATGTGGTGGCCGATATCGAGGCGGCCACCCTGTTCGGCA
ACAAGTATGTTGCGCTGTCCGCGCCGAAAATTCCTCAACAGCAGCGGATTTCCTCACATGACGTGATTGA
TGTGGGGTCGGTGACCACCGAATTCAACACGTTGTTCGAGACGATCACCTCGATCGCCGAGAAGGTGGAT
CCGATCGAGCTGAACGCGACGCTGTCCGCGGTAGCACAGGCGCTGGATGGGCTGGGCGGCAAGTTCGGTG
AGTCGATCGTTAATGGCAATCAGATTCTGGCGCAATTAAATCCGCGGCTGCCGCAGCTCGGCTATGATGT
TCGGCGGTTGGCGGATCTCGGTGAGGTCTATGTCGATGCTTCGCCGGATCTGTGGTCCTTTCTGCAGAAC
GCACTGACCACTGCGCGCACATTGACCAGCCAACAGCGCGATCTGGATGCCGCGTTGTTGGCGGCTACGG
GTGCGGGCAACACCGGTGAAGACGTTTTTGCTCGAGGCGGGCCGTATCTTGCGCGCGCAGCCGCCGATCT
GGTGCCCACCGCTACGCTGCTGGACACCTACAGTCCCGAACTGTTCTGCATGATCCGCAACTTTCACGAC
GCTGCGCCCAAAGTCGCGGACGCGGTGGGCGGCAACGGCTATTCGCTAGCGGCCGCCGGAACGATTTTGG
GAGCACCCAATCCCTATGTCTATCCGGACAATCTGCCGCGGGTGAATGCCCACGGTGGACCCGGGGGCCG
ACCGGGCTGCTGGCAGACGATCACCCGGGAGCTGTGGCCGGCACCCTATCTGGTGATGGACACCGGTGCC
AGCCTCGCACCGTACAACCACGTCGAGCTCGGCCAACCGATGTTCACTGAATACGTATGGGGACGCCAAT
ACGGAGAGAACACGATCAACCCATG
Protein Sequence
>gi|15839991|ref|NP_335028.1| virulence factor [Mycobacterium tuberculosis CDC1551]
MPTLVTRKNRRAWLYVEGVVLLLVGALVLVLVYKQFRGEFTPKTELTMVASRAGLVMEAGSKVTYNGVEI
GRVGSISEIERDGRPAAKLVLDVNPRYISLIPVNVVADIEAATLFGNKYVALSAPKIPQQQRISSHDVID
VGSVTTEFNTLFETITSIAEKVDPIELNATLSAVAQALDGLGGKFGESIVNGNQILAQLNPRLPQLGYDV
RRLADLGEVYVDASPDLWSFLQNALTTARTLTSQQRDLDAALLAATGAGNTGEDVFARGGPYLARAAADL
VPTATLLDTYSPELFCMIRNFHDAAPKVADAVGGNGYSLAAAGTILGAPNPYVYPDNLPRVNAHGGPGGR
PGCWQTITRELWPAPYLVMDTGASLAPYNHVELGQPMFTEYVWGRQYGENTINP
Molecule Role Virmugen
Molecule Role Annotation Mce-2 and mce-3 mutants in Mycobacterium tuberculosis is attenuated and provide protection against challenge for mice (Aguilar et al., 2006).
Related Vaccines(s) Mycobacterium tuberculosis mce-2 mutant vaccine
References