VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

mce-3

Gene Name mce-3
Sequence Strain (Species/Organism) Mycobacterium tuberculosis CDC1551
NCBI Gene ID 923491
NCBI Protein GI 15841441
Locus Tag MT2018
Genbank Accession AE000516
Protein Accession NP_336478
Taxonomy ID 83331
Gene Starting Position 2206659
Gene Ending Position 2207936
Gene Strand (Orientation) +
Protein Name virulence factor
Protein pI 6.51
Protein Weight 41527.31
Protein Length 425
Protein Note identified by similarity to GP:5814111; match to protein family HMM PF02470; match to protein family HMM TIGR00996
DNA Sequence
>gi|50953765:2206659-2207936 Mycobacterium tuberculosis CDC1551, complete genome
CATGAGACGCGGGCCGGGTCGACACCGTTTGCACGACGCGTGGTGGACGCTGATCCTGTTCGCGGTGATC
GGGGTGGCTGTCCTGGTGACGGCGGTGTCCTTCACGGGCAGCTTGCGGTCGACTGTGCCGGTGACGCTGG
CGGCCGACCGCTCCGGGCTGGTGATGGACTCCGGCGCCAAGGTCATGATGCGCGGTGTGCAGGTCGGCCG
GGTCGCCCAGATCGGTCGGATCGAGTGGGCCCAGAACGGGGCGAGCCTCAGACTGGAGATCGACCCCGAC
CAGATCCGGTACATCCCGGCCAATGTCGAGGCACAGATCAGCGCCACCACCGCATTCGGTGCCAAGTTCG
TCGACCTGGTGATGCCGCAAAACCCAAGTCGTGCACGGCTGTCCGCTGGGGCGGTACTGCATTCGAAGAA
CGTCAGCACGGAAATCAACACCGTCTTCGAAAACGTCGTCGACCTGCTCAACATGATCGACCCGCTGAAA
CTGAACGCCGTGCTGACCGCGGTCGCCGACGCCGTTCGCGGGCAAGGTGAACGGATAGGCCAGGCCACCA
CCGACCTCAACGAGGTGCTGGAGGCACTCAACGCACGCGGCGACACCATCGGCGGCAACTGGCGATCGCT
CAAGAACTTCACCGACACCTATGACGCGGCCGCCCAAGACATCCTGACGATCCTGAACGCCGCCAGCACC
ACCAGTGCGACCGTCGTGAATCATTCGACGCAGCTGGATGCCTTGCTACTCAACGCCATCGGACTATCCA
ACGCTGGCACCAACCTGCTTGGCAGCAGCCGAGACAATCTCGTCGGCGCGGCCGACATCCTGGCGCCGAC
CACGAGCCTGCTGTTCAAGTACAACCCCGAATACACCTGCTTCCTGCAGGGCGCCAAGTGGTATCTCGAC
AACGGCGGCTATGCGGCCTGGGGCGGGGCCGACGGGCGCACGCTACAACTCGATGTGGCGCTACTGTTCG
GCAACGACCCCTATGTCTATCCGGACAACCTGCCGGTTGTCGCGGCCAAGGGGGGTCCCGGCGGAAGGCC
GGGATGCGGGCCATTGCCGGATGCCACCCACAACTTCCCGGTGCGCCAGCTGGTCACCAACACCGGATGG
GGAACCGGGCTGGACATCCGGCCCAACCCCGGCATCGGGCATCCCTGCTGGGCCAACTACTTCCCGGTGA
CCCGCGCGGTGCCCGAGCCGCCGTCGATCCGTCAGTGCATCCCCGGGCCGGCGATCGGGCCCAACCCCGC
GGCGGGGGAGCAGCCATG
Protein Sequence
>gi|15841441|ref|NP_336478.1| virulence factor [Mycobacterium tuberculosis CDC1551]
MRRGPGRHRLHDAWWTLILFAVIGVAVLVTAVSFTGSLRSTVPVTLAADRSGLVMDSGAKVMMRGVQVGR
VAQIGRIEWAQNGASLRLEIDPDQIRYIPANVEAQISATTAFGAKFVDLVMPQNPSRARLSAGAVLHSKN
VSTEINTVFENVVDLLNMIDPLKLNAVLTAVADAVRGQGERIGQATTDLNEVLEALNARGDTIGGNWRSL
KNFTDTYDAAAQDILTILNAASTTSATVVNHSTQLDALLLNAIGLSNAGTNLLGSSRDNLVGAADILAPT
TSLLFKYNPEYTCFLQGAKWYLDNGGYAAWGGADGRTLQLDVALLFGNDPYVYPDNLPVVAAKGGPGGRP
GCGPLPDATHNFPVRQLVTNTGWGTGLDIRPNPGIGHPCWANYFPVTRAVPEPPSIRQCIPGPAIGPNPA
AGEQP
Molecule Role Virmugen
Molecule Role Annotation Mce-2 and mce-3 mutants in Mycobacterium tuberculosis is attenuated and provide protection against challenge for mice (Aguilar et al., 2006).
Related Vaccines(s) Mycobacterium tuberculosis mce-2 mutant vaccine , Mycobacterium tuberculosis mce-3 mutant vaccine
References