VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

sodA

Gene Name sodA
Sequence Strain (Species/Organism) Yersinia enterocolitica subsp. enterocolitica 8081
NCBI Gene ID 4716532
NCBI Protein GI 123444307
Locus Tag YE4138
Genbank Accession AM286415
Protein Accession YP_001008274
Taxonomy ID 393305
Gene Starting Position 4530099
Gene Ending Position 4530722
Gene Strand (Orientation) +
Protein Name superoxide dismutase
Protein pI 6.73
Protein Weight 22109.22
Protein Length 207
Protein Note SodA; manganese binding; only present under aerobic conditions; destroys free radicals
DNA Sequence
>gi|123440403:4530099-4530722 Yersinia enterocolitica subsp. enterocolitica 8081, complete genome
TATGAGTTACTCACTGCCATCCCTGCCTTATGCTTATGACGCCCTGGAACCACACTTCGATAAGCAGACG
ATGGAAATCCATCACACCAAACACCACCAAACCTATGTTAACAATGCAAACACGGTGTTGGAGAGCTTCC
CTGAACTGGCTAAATTCAGTGTTGAAGATCTGATCAAAGATCTGGACAAAGTTCCAGCTGAAAAACGCAC
CTTTATGCGTAATAACGCCGGCGGTCACGCTAACCACAGCCTGTTCTGGAAGGGCTTGAAACTGGGCACC
ACTCTGACCGGTGACCTGAAAGCCGCTATCGAGCGCGACTTCGGCAGCATTGACAGCTTCAAAGAAAAAT
TTGAACAAGCTGCGGCAACGCGTTTCGGTTCAGGCTGGGCCTGGCTGGTACTGAAAGACGACGGCAAACT
GGCTGTTGTTTCGACTGCTAACCAAGACAGCCCGCTGATGGGTGAAGCTGTTTCTGGCGCATCAGGTTTC
CCAATTGTGGGCCTGGATGTGTGGGAACACGCTTACTATCTGAAATTCCAAAACCGCCGCCCAGACTACA
TCAAAGCATTCTGGAACGTGGTTAACTGGGACGAAGCAGCCGCGCGCTTCGCTCAAGCTAAGTA
Protein Sequence
>gi|123444307|ref|YP_001008274.1| superoxide dismutase [Yersinia enterocolitica subsp. enterocolitica 8081]
MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELAKFSVEDLIKDLDKVPAEKRT
FMRNNAGGHANHSLFWKGLKLGTTLTGDLKAAIERDFGSIDSFKEKFEQAAATRFGSGWAWLVLKDDGKL
AVVSTANQDSPLMGEAVSGASGFPIVGLDVWEHAYYLKFQNRRPDYIKAFWNVVNWDEAAARFAQAK
Molecule Role Virmugen
Molecule Role Annotation A sodA mutant in Yersinia enterocolitica was highly attenuated and mice immunized with a single oral dose of the mutant strain were protected against a lethal oral-challenge infection with wild-type Y. enterocolitica (Igwe et al., 1999).
Related Vaccines(s) Yersinia enterocolitica sodA mutant vaccine
References