VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

asp24

Gene Name asp24
NCBI Nucleotide GI 2352999
NCBI Protein GI 2353000
Protein Accession AAB69346.1
Other Database IDs CDD:151121
Taxonomy ID 235
Gene Strand (Orientation) ?
Protein Name acid shock protein
Protein Length 184
Protein Note Secreted protein acidic and rich in cysteine Ca binding region; pfam10591
Protein Sequence
>gi|2353000|gb|AAB69346.1| acid shock protein [Brucella abortus]
MESRTMKSKTAFIAVIATSLFAIPALAQEKSNANTDKPAAEAAVSSNQDAKNKRGPIDLEKFSRMDQLKA
ADTNGDGVLSRDEIEALALKRVVSRAADRMERRLDVNGDGKVTLDEIQNQRKKEFAALDRNDDGKLDRHE
MRAAKMSHRGHKGHHEMGKHHKSGDHKGGDHKGPMKTKAQKPQE
Molecule Role Virmugen
Molecule Role Annotation A asp24 mutation in Brucella abortus is attenuated and provides significant protection in mice (Kahl-McDonagh et al., 2007).
Related Vaccines(s) B. abortus and B. melitensis mutants with unmarked deletion of asp24, virB2, or manBA
References