VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

virB2

Gene Name virB2
Sequence Strain (Species/Organism) Brucella melitensis biovar Abortus 2308
NCBI Gene ID 3827981
NCBI Protein GI 83269021
Locus Tag BAB2_0067
Genbank Accession AM040265
Protein Accession YP_418312
Taxonomy ID 359391
Chromosome No II
Gene Starting Position 65610
Gene Ending Position 65927
Gene Strand (Orientation) -
Protein Name type IV secretion system protein VirB2
Protein pI 10.63
Protein Weight 10115.27
Protein Length 105
DNA Sequence
>gi|83268957:65610-65927 Brucella melitensis biovar Abortus 2308 chromosome chromosome II, complete sequence
TTTACCTAAGCAGGTAAGAGGCAATTTCGGCGGCAGCGCCAACCACCAGGGCGCCGCCCAGCACCGGCAC
TACATCCATGAAGCGGGCGTGCCGGAATGCCATCTTGTAACCGGACCAGATGATGGCTATGGTAACGATG
GTGATCGATACGCCGCTTAGCAAGTCCAGCACTTTTTGCATGCTTGTATTTACCTTATCGAGGCCACCGT
TGGCGTGCGCCAGGTTAGGCTCGATTGCAGCGATGGAGACAATGAGGGCCAGCAGTAGGTGAGGTAGAAT
CCGCGACAGCGACTTCTTGCTGGGGGAAGCGGTTTTCA
Protein Sequence
>gi|83269021|ref|YP_418312.1| type IV secretion system protein VirB2 [Brucella melitensis biovar Abortus 2308]
MKTASPSKKSLSRILPHLLLALIVSIAAIEPNLAHANGGLDKVNTSMQKVLDLLSGVSITIVTIAIIWSG
YKMAFRHARFMDVVPVLGGALVVGAAAEIASYLLR
Molecule Role Virmugen
Molecule Role Annotation A virB2 mutant is attenuated in Brucella abortus and provides protection in mice (Kahl-McDonagh et al., 2007).
Related Vaccines(s) B. abortus and B. melitensis mutants with unmarked deletion of asp24, virB2, or manBA
References