VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

manB

Gene Name manB
Sequence Strain (Species/Organism) Brucella melitensis bv. 1 str. 16M
NCBI Gene ID 1198671
NCBI Protein GI 17989244
Locus Tag BMEII0899
Genbank Accession AE008918
Protein Accession NP_541877
Taxonomy ID 224914
Chromosome No II
Gene Starting Position 940999
Gene Ending Position 942432
Gene Strand (Orientation) +
Protein Name phosphomannomutase
Protein pI 6.8
Protein Weight 47237.87
Protein Length 477
Protein Note 5.4.2.8
DNA Sequence
>gi|17988344:940999-942432 Brucella melitensis bv. 1 str. 16M chromosome II, complete sequence
CATGAGCAGCAATTCCCTCAAATTTGGCACGAGCGGCCTTCGCGGGCTGGCGGTAGAACTGAACGGCCTG
CCCGCCTATGCCTATACGATGGCCTTTGTGCAGATGCTTGCTGCAAAAGGGCAGTTGCAGAAGGGCGACA
AGGTGTTTGTCGGCAGGGATTTGCGCCCCTCCAGCCCTGATATTGCAGCCCTTGCCATGGGTGCCATCGA
AGATGCCGGCTTCACACCGGTCAATTGCGGCGTCCTGCCCACGCCTGCGCTGAGCTATTATGCGATGGGC
GCGAAAGCACCCAGCATCATGGTCACGGGAAGCCATATTCCAGATGATCGCAACGGGCTGAAATTCTATC
GCCGCGACGGTGAAATCGACAAGGATGATGAGGCGGCAATCAGTGCAGCCTATCGCAAGCTGCCTGCCAT
TCTCGCTGCCCGCAAACATGTCGGCTCCACCGAAACCGATGCGGCCTTGCAGGCTTATGCCGATCGCTAT
GCAGGTTTTCTTGGGAAAGGGAGCCTGAATGGCCTGCGGGTCGGCGTTTATCAACATTCTTCCGTGGCGC
GCGATCTTCTGATGTACCTGCTCACGACACTCGGCGTGGAACCCGTGGCGCTCGGACGATCCGATATATT
CGTGCCGGTCGATACCGAGGCATTGCGCCCCGAAGACATTGCGCTGCTTGCCCAATGGGGCAAAAGCGAC
AGGCTTGATGCCATCGTCTCCACCGACGGAGACGCGGATCGCCCGCTGATTGCCGATGAGCATGGACAAT
TCGTTCGCGGCGATCTTGCTGGCGCCATCACCGCCACATGGGTGGGGGCGGATACGCTCGTCACGCCAGT
CACCTCCAACACCGCATTGGAAAGCCGCTTTCCCAAGGTTTTGAGAACGCGCGTCGGTTCGCCTTATGTC
ATCGCAAGCATGGCACAGGTATCCACGGGCAATTCCGGCCCGGTCATCGGGTTTGAGGCCAATGGCGGCG
TTCTGCTTGGCAGCACGGTCGAGAGGAATGGACGAAGCCTGACGGCCCTGCCGACGCGCGACGCCTTGTT
GCCCATTCTGGCTTGCCTTGCCACGGTTCACGAAAAGAAAACGCCGCTTTCAACAATCGCCCGGTCCTAT
GGCTTCCGCGTCGCGCTTAGCGACCGGCTGCAAAACATTCCGCAGGAGGCGAGCACCGCCTTCCTCGCGC
TCTTGGAGGATGCGGATAAACGCGCCTCGCTCTTTCCTGCTGGCGACGCAATCGTGCGGGTGGAAACCAT
CGACGGCGTGAAGCTTTTCTTTCAATCAGGCAATGCGGTTCATTATCGGGCATCGGGCAATGCGCCGGAA
CTGCGCTGCTATGTGGAATCTTCGGATGACACACAAGCCGCCAAGCTTCAGGCGCTTGGCTTGGAAATCG
CACGCAAAGCACTAAAGGATGCGACGAGGCCATG
Protein Sequence
>gi|17989244|ref|NP_541877.1| phosphomannomutase [Brucella melitensis bv. 1 str. 16M]
MSSNSLKFGTSGLRGLAVELNGLPAYAYTMAFVQMLAAKGQLQKGDKVFVGRDLRPSSPDIAALAMGAIE
DAGFTPVNCGVLPTPALSYYAMGAKAPSIMVTGSHIPDDRNGLKFYRRDGEIDKDDEAAISAAYRKLPAI
LAARKHVGSTETDAALQAYADRYAGFLGKGSLNGLRVGVYQHSSVARDLLMYLLTTLGVEPVALGRSDIF
VPVDTEALRPEDIALLAQWGKSDRLDAIVSTDGDADRPLIADEHGQFVRGDLAGAITATWVGADTLVTPV
TSNTALESRFPKVLRTRVGSPYVIASMAQVSTGNSGPVIGFEANGGVLLGSTVERNGRSLTALPTRDALL
PILACLATVHEKKTPLSTIARSYGFRVALSDRLQNIPQEASTAFLALLEDADKRASLFPAGDAIVRVETI
DGVKLFFQSGNAVHYRASGNAPELRCYVESSDDTQAAKLQALGLEIARKALKDATRP
Molecule Role Virmugen
Molecule Role Annotation Mutants manB and manA were attenuated in Brucella melitensis and provided protection against challenge in mice's livers (Kahl-McDonagh et al., 2007).
Related Vaccines(s) B. abortus and B. melitensis mutants with unmarked deletion of asp24, virB2, or manBA
References