VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Yersinia pseudotuberculosis

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
  2. Vaccine Related Pathogen Genes
    1. opJ (Protective antigen)
    2. Porin (Protective antigen)
    3. pYV0055 (Protective antigen)
    4. yopE (Protective antigen)
    5. phoP (Virmugen)
  3. Vaccine Information
    1. Yersinia pseudotuberculosis phoP mutant vaccine
  4. References
I. General Information
1. NCBI Taxonomy ID:
633
2. Disease:
Yersiniosis
3. Introduction
Yersinia pseudotuberculosis is a Gram-negative bacterium which primarily causes disease in animals; humans occasionally get infected zoonotically, most often through the food-borne route. In animals, Y. pseudotuberculosis can cause tuberculosis-like symptoms, including localized tissue necrosis and granulomas in the spleen, liver, and lymph node. In humans, symptoms are similar to those of infection with Yersinia enterocolitica (fever and right-sided abdominal pain), except that the diarrheal component is often absent, which sometimes makes the resulting condition difficult to diagnose. Y. pseudotuberculosis infections can mimic appendicitis, especially in children and younger adults, and, in rare cases the disease may cause skin complaints (erythema nodosum), joint stiffness and pain (reactive arthritis), or spread of bacteria to the blood (bacteremia) (Wiki: Y. pseudotuberuclosis).
1. opJ
  • Gene Name : opJ
  • Sequence Strain (Species/Organism) : Yersinia pseudotuberculosis
  • NCBI Protein GI : AAT28340
  • Other Database IDs : CDD:185269
  • Taxonomy ID : 633
  • Protein Name : outer protein J
  • Protein pI : 7.27
  • Protein Weight : 31206.2
  • Protein Length : 362
  • Protein Note : YopJ
  • Protein Sequence : Show Sequence
    >AAT28340.1 outer protein J (plasmid) [Yersinia pseudotuberculosis]
    MIGPISQINISGGLSEKETSSLISNEELKNIITQLETDISDGSWFHKNYSRMDVEVMPALVIQANNKYPE
    MNLNLVTSPLDLSIEIKNVIENGVRSSRFIINMGEGGIHFSVIDYKHINGKTSLILFEPANFNSMGPAML
    AIRTKTAIERYQLPDCHFSMVEMDIQRSSSECGIFSFALAKKLYIERDSLLKIHEDNIKGILSDGENPLP
    HDKLDPYLPVTFYKHTQGKKRLNEYLNTNPQGVGTVVNKKNETIVNRFDNNKSIVDGKELSVSVHKKRIA
    EYKTLLKV
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Zhang and Bliska, 2010)
2. phoP
  • Gene Name : phoP
  • Sequence Strain (Species/Organism) : Yersinia pseudotuberculosis IP 32953
  • NCBI Gene ID : 2956268
  • NCBI Protein GI : 51596756
  • Locus Tag : YPTB2434
  • Genbank Accession : BX936398
  • Protein Accession : YP_070947
  • Taxonomy ID : 273123
  • Gene Starting Position : 2877188
  • Gene Ending Position : 2877859
  • Gene Strand (Orientation) : +
  • Protein Name : DNA-binding transcriptional regulator PhoP
  • Protein pI : 5.6
  • Protein Weight : 23966.83
  • Protein Length : 223
  • Protein Note : response regulator in two-component regulatory system with PhoQ; involved in magnesium starvation and stress
  • DNA Sequence : Show Sequence
    >gi|51594359:2877188-2877859 Yersinia pseudotuberculosis IP 32953, complete genome
    TATGCGGGTTCTGGTTGTGGAAGATAACGCGTTGTTGCGTCACCATCTGACAGTGCAAATGCGTGAAATG
    GGCCATCAGGTTGATGCCGCGGAAGATGCTAAAGAAGCAGACTATTTCTTACAAGAGCATGCCCCCGACA
    TTGCTATTATCGATCTTGGTTTGCCCGGTGAAGACGGGTTAAGCCTTATCCGTCGCTGGCGTAGCCATCA
    AGAAAACTTACCCATTTTGGTCCTGACCGCACGGGAAAGCTGGCAAGATAAAGTCGCTGTACTGGAAGCC
    GGTGCCGACGATTATGTGACCAAACCGTTCCATCTGGAAGAGGTCATTGCCCGGATGCAAGCACTGATGC
    GGCGGAATATTGGCCTGGCCTCCCAAATTATTGAGCTACCGCCCTTCCAGATTGACCTTTCACGCCGTGA
    GTTATGTGTTAACCAACAACAAATTAAACTGACGGCATTTGAATACACTATCATTGAAACCCTTATCCGC
    AACGCAGGGAAAGTCGTTAGTAAGGATACGTTGATGCTACAACTTTATCCGGATGCGGAATTGCGAGAGA
    GCCATACTATCGATGTATTAATGGGTCGACTACGTAAAAAACTGCTGGCAGAACATCAGGGTGAAGTCAT
    TACGACTATTCGTGGTCAGGGATATCGTTTTGACGTCAACTA
  • Protein Sequence : Show Sequence
    >gi|51596756|ref|YP_070947.1| DNA-binding transcriptional regulator PhoP [Yersinia pseudotuberculosis IP 32953]
    MRVLVVEDNALLRHHLTVQMREMGHQVDAAEDAKEADYFLQEHAPDIAIIDLGLPGEDGLSLIRRWRSHQ
    ENLPILVLTARESWQDKVAVLEAGADDYVTKPFHLEEVIARMQALMRRNIGLASQIIELPPFQIDLSRRE
    LCVNQQQIKLTAFEYTIIETLIRNAGKVVSKDTLMLQLYPDAELRESHTIDVLMGRLRKKLLAEHQGEVI
    TTIRGQGYRFDVN
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A phoP mutant in Yersinia pseudotuberculosis (Yptb) was attenuated and provided protection against oral challenge with virulent Yptb in mice (Balada-Llasat et al., 2007).
  • Related Vaccine(s): Yersinia pseudotuberculosis phoP mutant vaccine
3. Porin
  • Gene Name : Porin
  • Sequence Strain (Species/Organism) : Yersinia pseudotuberculosis
  • NCBI Protein GI : WP_050103071
  • Other Database IDs : CDD:304382
    CDD:290340
    CDD:238208
  • Taxonomy ID : 633
  • Protein Name : porin OmpF2
  • Protein pI : 5.49
  • Protein Weight : 39303.36
  • Protein Length : 436
  • Protein Note : Porin superfamily. These outer membrane channels share a beta-barrel structure that differ in strand and shear number. Classical (gram-negative) porins are non-specific channels for small hydrophillic molecules and form 16 beta-stranded barrels (16,20)...; cl21487
  • Protein Sequence : Show Sequence
    >WP_050103071.1 porin OmpF2 [Yersinia pseudotuberculosis]
    MKRNILAILIPTLLVATTSHAAEIYNKDGNKLDLYGKVKALHYFSDNTKSDGDKSYVRLGFKGVTQITDE
    LSGYGQWEYNFAANYAESQEAKDNKTRLAFAGLRYSNLGSIDYGRNYGVLYDIAAWTDMLPEFGNDSYTR
    TDNFMTGRTTGVATYRNTDFFGLVDGLKFSLQYQGKNGAEGETNNGRADTSKQNGDGFGLSSSYEIGAGV
    SVGAAYASSNRTLAQKNSTFGKGDKADAWTTGLKYSDNGVYLAATYAETRNMTPISGTAVINNVSTSVSG
    FANKTQNIELVAQYLFDFGLKPSIAYIQSKGKDIEGIGDTDLVKYVDIGATYYFNKNMSTYVDYKINQLN
    DDNKLKLNTDNVVALGLVYQF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Tsybul'ski? et al., 2011)
4. pYV0055
  • Gene Name : pYV0055
  • Sequence Strain (Species/Organism) : Yersinia pseudotuberculosis IP 32953
  • VO ID : VO_0011016
  • NCBI Gene ID : 2952948
  • NCBI Protein GI : 51593897
  • Locus Tag : pYV0055
  • Genbank Accession : BX936399
  • Protein Accession : YP_068464
  • Taxonomy ID : 273123
  • Plasmid No : pYV
  • Gene Starting Position : 37489
  • Gene Ending Position : 38694
  • Gene Strand (Orientation) : -
  • Protein Name : yopB; Yop targeting protein
  • Protein pI : 7.3
  • Protein Weight : 38322.89
  • Protein Length : 401
  • Protein Note : similar to Y. pestis YPCD1.29c
  • DNA Sequence : Show Sequence
    >NC_006153.2:37489-38694 Yersinia pseudotuberculosis IP32953 pYV plasmid, complete sequence
    CTTAAACAGTATGGGGTCTGCCGGCCAAATTATGCAGCATGTCACCTTTTGCATTAATCATCTGGAAAAT
    CAGTTCCATCACTTGTTGATGTGACTCTGACAAATGGGATAATTCTTCTTTGAGTCGGTCAATAATACTT
    TGTAACGCTGCCATGTCTGCCTTGTTCAAGGCCAAATCAGCGTTATTATGTTGTAAATCAGCTTGCTTTT
    TATTATTGATGGTCTGAGTTATTCCGCTGCCCACACCAACGGCGACTTGTGTTGCCTGTGATCCTGTACG
    GATTGCATGGCTCATTGTTAAACCAGCAAAACTGCCCCCTAATTTAGTCACTGCACTCCCGACAGTGTTT
    GATATGCCTGTCGAAATTTGGGCAACTTTGGCCGAAAACTCGGCTCCTTTAGCCGCAAGACTTGCGGTGT
    TAGCACCGAGTTTTGCGCCAATATTAGCCAGGCATTTTAGTGCCGAACCGCCAAAGGTCATTACGGTTGA
    AACTACAGTCAATGCGACTTCAATCGCAGTGAGTATCGGCCCTAATATTTTCATTGCCTCTTGGGATATC
    AGGCCATCTTCCGCCGCTTGTTTCACTGCCATATTCGCCATCCCAATTACGCCTGAGGCAACCATCATTG
    CACCGGCAACGGCTCCTACCCCTGAGGCCACCATGATGGCACCGACAATCACTGAGGCTATGGCGCTGAG
    CCAGCCAAAAATCTTTGATGCAATGCCGGATTTCTTGACTTGCTTGGCATTCTCTTCTGTTTCTTTGATT
    TTCTCTTGATTCTCTTCAATTTTCTTCATGTTTTGTTCATGAAGACGCTGAATATCAGCGATTTTTATGT
    CTTTGCGTACTTCTTCTAAATTAGAAACTAGCTTACCTAACTCAATCTCAAATGTATCAGGTGAAGCAAG
    CGTAAACTTCGTTAGCACTGAAACATAATTTGATATCAGTTGAGATCCTGCCGCGCCGCGGGTGACCGAC
    TCCAATAATTTAGTGACTTCTTGCTGTTGTCCTTCAGTAACTTGGCTGGCAACCACTGCTAGTGGTGCAG
    GGAGCTGTACGCCCTGAGAACTCACCCCGCCATTTTTATCCTTCAGTTCTCCCGCGACTTGTTGGGTCTG
    AAGGGGGGCGGGCGCTGGTGTCTCGACGTAGGGAAGTAGACTTCCAGTTACTGGCGTTGAGCGGTCATGG
    GTTATCAACGCACTCA
    
    
  • Protein Sequence : Show Sequence
    >YP_068464.1 yopB; Yop targeting protein (plasmid) [Yersinia pseudotuberculosis IP 32953]
    MSALITHDRSTPVTGSLLPYVETPAPAPLQTQQVAGELKDKNGGVSSQGVQLPAPLAVVASQVTEGQQQE
    VTKLLESVTRGAAGSQLISNYVSVLTKFTLASPDTFEIELGKLVSNLEEVRKDIKIADIQRLHEQNMKKI
    EENQEKIKETEENAKQVKKSGIASKIFGWLSAIASVIVGAIMVASGVGAVAGAMMVASGVIGMANMAVKQ
    AAEDGLISQEAMKILGPILTAIEVALTVVSTVMTFGGSALKCLANIGAKLGANTASLAAKGAEFSAKVAQ
    ISTGISNTVGSAVTKLGGSFAGLTMSHAIRTGSQATQVAVGVGSGITQTINNKKQADLQHNNADLALNKA
    DMAALQSIIDRLKEELSHLSESHQQVMELIFQMINAKGDMLHNLAGRPHTV
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Complexes of YopB (pYV0055), YopD, and YopE (BDE) secreted by Yersinia pseudotuberculosis were purified by affinity chromatography and used as immunogens to determine if antibodies to the translocon could provide protection against Y. pestis in mice. The YopB protein or a complex of YopB and YopD (BD) was purified and determined by vaccination to be immunogenic in mice. Mice actively vaccinated with BD or passively vaccinated with anti-BD serum were protected against lethal challenge with F1(-) Y. pestis (Ivanov et al., 2008).
5. yopE
  • Gene Name : yopE
  • Sequence Strain (Species/Organism) : Yersinia pseudotuberculosis
  • NCBI Protein GI : AJJ04959
  • Other Database IDs : CDD:286154
    CDD:119405
  • Taxonomy ID : 633
  • Protein Name : outer membrane virulence protein yopE
  • Protein pI : 6.25
  • Protein Weight : 22357.55
  • Protein Length : 314
  • Protein Note : YopE, N terminal; pfam09020
  • Protein Sequence : Show Sequence
    >AJJ04959.1 outer membrane virulence protein yopE (plasmid) [Yersinia pseudotuberculosis]
    MKISSFISTSLPLPTSVSGSSSVGEMSGRSVSQQTSDQYANNLAGRTESPQGSSLASRIIERLSSVAHSV
    IGFIQRMFSEGSHKPVVTPAPTPAQMPSPTSFSDSIKQLAAETLPKYMQQLNSLDAEMLQKNHDQFATGS
    GPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTIGGAASAYVASGVDLTQAANEIKGLAQ
    QMQKLLSLM
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Zhang et al., 2012)
III. Vaccine Information
1. Yersinia pseudotuberculosis phoP mutant vaccine
a. Vaccine Ontology ID:
VO_0002947
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of phoP
f. Immunization Route
Oral immunization
g. Mouse Response
IV. References
1. Balada-Llasat et al., 2007: Balada-Llasat JM, Panilaitis B, Kaplan D, Mecsas J. Oral inoculation with Type III secretion mutants of Yersinia pseudotuberculosis provides protection from oral, intraperitoneal, or intranasal challenge with virulent Yersinia. Vaccine. 2007; 25(8); 1526-1533. [PubMed: 17194509].
2. Branger et al., 2009: Branger CG, Torres-Escobar A, Sun W, Perry R, Fetherston J, Roland KL, Curtiss R 3rd. Oral vaccination with LcrV from Yersinia pestis KIM delivered by live attenuated Salmonella enterica serovar Typhimurium elicits a protective immune response against challenge with Yersinia pseudotuberculosis and Yersinia enterocolitica. Vaccine. 2009; 27(39); 5363-5370. [PubMed: 19596407].
3. Daniel et al., 2009: Daniel C, Sebbane F, Poiret S, Goudercourt D, Dewulf J, Mullet C, Simonet M, Pot B. Protection against Yersinia pseudotuberculosis infection conferred by a Lactococcus lactis mucosal delivery vector secreting LcrV. Vaccine. 2009; 27(8); 1141-1144. [PubMed: 19135495].
4. Ivanov et al., 2008: Ivanov MI, Noel BL, Rampersaud R, Mena P, Benach JL, Bliska JB. Vaccination of mice with a Yop translocon complex elicits antibodies that are protective against infection with F1- Yersinia pestis. Infection and immunity. 2008; 76(11); 5181-5190. [PubMed: 18765742].
5. Najdenski et al., 2009: Najdenski H, Golkocheva-Markova E, Kussovski V, Vesselinova A, Garbom S, Wolf-Watz H. Attenuation and preserved immunogenic potential of Yersinia pseudotuberculosis mutant strains evidenced in oral pig model. Zoonoses and public health. 2009; 56(4); 157-168. [PubMed: 18793276].
6. Tsybul'ski? et al., 2011: Tsybul'ski? AV, Popov AM, Sanina NM, Maze?ka AN, Portniagina OIu, Novikova OD, Timchenko NF, Kostetski? ÉIa. [Immunogenic and protective properties of nanosized constructs based on tubular immunostimulating complexes and pore forming protein of Yersinia pseudotuberculosis]. Zhurnal mikrobiologii, epidemiologii, i immunobiologii. 2011; (2); 43-47. [PubMed: 21598614].
7. Wiki: Y. pseudotuberuclosis: Wiki: Y. pseudotuberuclosis [http://en.wikipedia.org/wiki/Yersinia_pseudotuberculosis]
8. Zhang and Bliska, 2010: Zhang Y, Bliska JB. YopJ-promoted cytotoxicity and systemic colonization are associated with high levels of murine interleukin-18, gamma interferon, and neutrophils in a live vaccine model of Yersinia pseudotuberculosis infection. Infection and immunity. 2010; 78(5); 2329-2341. [PubMed: 20231414].
9. Zhang et al., 2012: Zhang Y, Mena P, Romanov G, Lin JS, Smiley ST, Bliska JB. A protective epitope in type III effector YopE is a major CD8 T cell antigen during primary infection with Yersinia pseudotuberculosis. Infection and immunity. 2012; 80(1); 206-214. [PubMed: 22064714].