VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Yersinia pseudotuberculosis

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
  2. Vaccine Related Pathogen Genes
    1. pYV0055 (Protective antigen)
    2. phoP (Virmugen)
  3. Vaccine Information
    1. Yersinia pseudotuberculosis phoP mutant vaccine
  4. References
I. General Information
1. NCBI Taxonomy ID:
633
2. Disease:
Yersiniosis
3. Introduction
Yersinia pseudotuberculosis is a Gram-negative bacterium which primarily causes disease in animals; humans occasionally get infected zoonotically, most often through the food-borne route. In animals, Y. pseudotuberculosis can cause tuberculosis-like symptoms, including localized tissue necrosis and granulomas in the spleen, liver, and lymph node. In humans, symptoms are similar to those of infection with Yersinia enterocolitica (fever and right-sided abdominal pain), except that the diarrheal component is often absent, which sometimes makes the resulting condition difficult to diagnose. Y. pseudotuberculosis infections can mimic appendicitis, especially in children and younger adults, and, in rare cases the disease may cause skin complaints (erythema nodosum), joint stiffness and pain (reactive arthritis), or spread of bacteria to the blood (bacteremia) (Wiki: Y. pseudotuberuclosis).
1. phoP
  • Gene Name : phoP
  • Sequence Strain (Species/Organism) : Yersinia pseudotuberculosis IP 32953
  • NCBI Gene ID : 2956268
  • NCBI Protein GI : 51596756
  • Locus Tag : YPTB2434
  • Genbank Accession : BX936398
  • Protein Accession : YP_070947
  • Taxonomy ID : 273123
  • Gene Starting Position : 2877188
  • Gene Ending Position : 2877859
  • Gene Strand (Orientation) : +
  • Protein Name : DNA-binding transcriptional regulator PhoP
  • Protein pI : 5.6
  • Protein Weight : 23966.83
  • Protein Length : 223
  • Protein Note : response regulator in two-component regulatory system with PhoQ; involved in magnesium starvation and stress
  • DNA Sequence : Show Sequence
    >gi|51594359:2877188-2877859 Yersinia pseudotuberculosis IP 32953, complete genome
    TATGCGGGTTCTGGTTGTGGAAGATAACGCGTTGTTGCGTCACCATCTGACAGTGCAAATGCGTGAAATG
    GGCCATCAGGTTGATGCCGCGGAAGATGCTAAAGAAGCAGACTATTTCTTACAAGAGCATGCCCCCGACA
    TTGCTATTATCGATCTTGGTTTGCCCGGTGAAGACGGGTTAAGCCTTATCCGTCGCTGGCGTAGCCATCA
    AGAAAACTTACCCATTTTGGTCCTGACCGCACGGGAAAGCTGGCAAGATAAAGTCGCTGTACTGGAAGCC
    GGTGCCGACGATTATGTGACCAAACCGTTCCATCTGGAAGAGGTCATTGCCCGGATGCAAGCACTGATGC
    GGCGGAATATTGGCCTGGCCTCCCAAATTATTGAGCTACCGCCCTTCCAGATTGACCTTTCACGCCGTGA
    GTTATGTGTTAACCAACAACAAATTAAACTGACGGCATTTGAATACACTATCATTGAAACCCTTATCCGC
    AACGCAGGGAAAGTCGTTAGTAAGGATACGTTGATGCTACAACTTTATCCGGATGCGGAATTGCGAGAGA
    GCCATACTATCGATGTATTAATGGGTCGACTACGTAAAAAACTGCTGGCAGAACATCAGGGTGAAGTCAT
    TACGACTATTCGTGGTCAGGGATATCGTTTTGACGTCAACTA
  • Protein Sequence : Show Sequence
    >gi|51596756|ref|YP_070947.1| DNA-binding transcriptional regulator PhoP [Yersinia pseudotuberculosis IP 32953]
    MRVLVVEDNALLRHHLTVQMREMGHQVDAAEDAKEADYFLQEHAPDIAIIDLGLPGEDGLSLIRRWRSHQ
    ENLPILVLTARESWQDKVAVLEAGADDYVTKPFHLEEVIARMQALMRRNIGLASQIIELPPFQIDLSRRE
    LCVNQQQIKLTAFEYTIIETLIRNAGKVVSKDTLMLQLYPDAELRESHTIDVLMGRLRKKLLAEHQGEVI
    TTIRGQGYRFDVN
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A phoP mutant in Yersinia pseudotuberculosis (Yptb) was attenuated and provided protection against oral challenge with virulent Yptb in mice (Balada-Llasat et al., 2007).
  • Related Vaccine(s): Yersinia pseudotuberculosis phoP mutant vaccine
2. pYV0055
  • Gene Name : pYV0055
  • Sequence Strain (Species/Organism) : Yersinia pseudotuberculosis IP 32953
  • VO ID : VO_0011016
  • NCBI Gene ID : 2952948
  • NCBI Protein GI : 51593897
  • Locus Tag : pYV0055
  • Genbank Accession : BX936399
  • Protein Accession : YP_068464
  • Taxonomy ID : 273123
  • Plasmid No : pYV
  • Gene Starting Position : 37489
  • Gene Ending Position : 38694
  • Gene Strand (Orientation) : -
  • Protein Name : yopB; putative Yop targeting protein
  • Protein pI : 7.3
  • Protein Weight : 38322.89
  • Protein Length : 401
  • Protein Note : similar to Y. pestis YPCD1.29c
  • DNA Sequence : Show Sequence
    >gi|113911685:37489-38694 Yersinia pseudotuberculosis IP 32953 plasmid pYV, complete sequence
    CTTAAACAGTATGGGGTCTGCCGGCCAAATTATGCAGCATGTCACCTTTTGCATTAATCATCTGGAAAAT
    CAGTTCCATCACTTGTTGATGTGACTCTGACAAATGGGATAATTCTTCTTTGAGTCGGTCAATAATACTT
    TGTAACGCTGCCATGTCTGCCTTGTTCAAGGCCAAATCAGCGTTATTATGTTGTAAATCAGCTTGCTTTT
    TATTATTGATGGTCTGAGTTATTCCGCTGCCCACACCAACGGCGACTTGTGTTGCCTGTGATCCTGTACG
    GATTGCATGGCTCATTGTTAAACCAGCAAAACTGCCCCCTAATTTAGTCACTGCACTCCCGACAGTGTTT
    GATATGCCTGTCGAAATTTGGGCAACTTTGGCCGAAAACTCGGCTCCTTTAGCCGCAAGACTTGCGGTGT
    TAGCACCGAGTTTTGCGCCAATATTAGCCAGGCATTTTAGTGCCGAACCGCCAAAGGTCATTACGGTTGA
    AACTACAGTCAATGCGACTTCAATCGCAGTGAGTATCGGCCCTAATATTTTCATTGCCTCTTGGGATATC
    AGGCCATCTTCCGCCGCTTGTTTCACTGCCATATTCGCCATCCCAATTACGCCTGAGGCAACCATCATTG
    CACCGGCAACGGCTCCTACCCCTGAGGCCACCATGATGGCACCGACAATCACTGAGGCTATGGCGCTGAG
    CCAGCCAAAAATCTTTGATGCAATGCCGGATTTCTTGACTTGCTTGGCATTCTCTTCTGTTTCTTTGATT
    TTCTCTTGATTCTCTTCAATTTTCTTCATGTTTTGTTCATGAAGACGCTGAATATCAGCGATTTTTATGT
    CTTTGCGTACTTCTTCTAAATTAGAAACTAGCTTACCTAACTCAATCTCAAATGTATCAGGTGAAGCAAG
    CGTAAACTTCGTTAGCACTGAAACATAATTTGATATCAGTTGAGATCCTGCCGCGCCGCGGGTGACCGAC
    TCCAATAATTTAGTGACTTCTTGCTGTTGTCCTTCAGTAACTTGGCTGGCAACCACTGCTAGTGGTGCAG
    GGAGCTGTACGCCCTGAGAACTCACCCCGCCATTTTTATCCTTCAGTTCTCCCGCGACTTGTTGGGTCTG
    AAGGGGGGCGGGCGCTGGTGTCTCGACGTAGGGAAGTAGACTTCCAGTTACTGGCGTTGAGCGGTCATGG
    GTTATCAACGCACTCA
  • Protein Sequence : Show Sequence
    >gi|51593897|ref|YP_068464.1| yopB; putative Yop targeting protein [Yersinia pseudotuberculosis IP 32953]
    MSALITHDRSTPVTGSLLPYVETPAPAPLQTQQVAGELKDKNGGVSSQGVQLPAPLAVVASQVTEGQQQE
    VTKLLESVTRGAAGSQLISNYVSVLTKFTLASPDTFEIELGKLVSNLEEVRKDIKIADIQRLHEQNMKKI
    EENQEKIKETEENAKQVKKSGIASKIFGWLSAIASVIVGAIMVASGVGAVAGAMMVASGVIGMANMAVKQ
    AAEDGLISQEAMKILGPILTAIEVALTVVSTVMTFGGSALKCLANIGAKLGANTASLAAKGAEFSAKVAQ
    ISTGISNTVGSAVTKLGGSFAGLTMSHAIRTGSQATQVAVGVGSGITQTINNKKQADLQHNNADLALNKA
    DMAALQSIIDRLKEELSHLSESHQQVMELIFQMINAKGDMLHNLAGRPHTV
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Complexes of YopB (pYV0055), YopD, and YopE (BDE) secreted by Yersinia pseudotuberculosis were purified by affinity chromatography and used as immunogens to determine if antibodies to the translocon could provide protection against Y. pestis in mice. The YopB protein or a complex of YopB and YopD (BD) was purified and determined by vaccination to be immunogenic in mice. Mice actively vaccinated with BD or passively vaccinated with anti-BD serum were protected against lethal challenge with F1(-) Y. pestis (Ivanov et al., 2008).
III. Vaccine Information
1. Yersinia pseudotuberculosis phoP mutant vaccine
a. Vaccine Ontology ID:
VO_0002947
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of phoP
f. Immunization Route
Oral immunization
g. Mouse Response
IV. References
1. Balada-Llasat et al., 2007: Balada-Llasat JM, Panilaitis B, Kaplan D, Mecsas J. Oral inoculation with Type III secretion mutants of Yersinia pseudotuberculosis provides protection from oral, intraperitoneal, or intranasal challenge with virulent Yersinia. Vaccine. 2007; 25(8); 1526-1533. [PubMed: 17194509].
2. Ivanov et al., 2008: Ivanov MI, Noel BL, Rampersaud R, Mena P, Benach JL, Bliska JB. Vaccination of mice with a Yop translocon complex elicits antibodies that are protective against infection with F1- Yersinia pestis. Infection and immunity. 2008; 76(11); 5181-5190. [PubMed: 18765742].
3. Najdenski et al., 2009: Najdenski H, Golkocheva-Markova E, Kussovski V, Vesselinova A, Garbom S, Wolf-Watz H. Attenuation and preserved immunogenic potential of Yersinia pseudotuberculosis mutant strains evidenced in oral pig model. Zoonoses and public health. 2009; 56(4); 157-168. [PubMed: 18793276].
4. Wiki: Y. pseudotuberuclosis: Wiki: Y. pseudotuberuclosis [http://en.wikipedia.org/wiki/Yersinia_pseudotuberculosis]