VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Ebola virus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Microbial Pathogenesis
    5. Host Ranges and Animal Models
    6. Host Protective Immunity
  2. Vaccine Related Pathogen Genes
    1. GP from Cote d'Ivoire Ebola virus (Other)
    2. NP from Zaire Ebola virus (Other)
    3. EBOV NP (Protective antigen)
    4. GP from Reston ebolavirus (Protective antigen)
    5. GP from Sudan ebolavirus (Protective antigen)
    6. GP from Zaire ebolavirus (Protective antigen)
    7. NP (Protective antigen)
    8. pagA (Protective antigen)
    9. SGP (Protective antigen)
    10. VP24 (Protective antigen)
    11. VP24 from Reston ebolavirus (Protective antigen)
    12. VP24 from Zaire ebolavirus (Protective antigen, Protective antigen)
    13. VP30 (Protective antigen)
    14. VP30 from Reston ebolavirus (Protective antigen)
    15. VP30 from Zaire ebolavirus (Protective antigen, Protective antigen)
    16. VP35 (Protective antigen)
    17. VP35 from Reston ebolavirus (Protective antigen)
    18. VP35 from Zaire ebolavirus (Protective antigen, Protective antigen)
    19. VP40 from Reston ebolavirus (Protective antigen)
    20. VP40 from Zaire ebolavirus (Protective antigen)
    21. ZGP (Protective antigen)
  3. Vaccine Information
    1. cAdVax-based bivalent ebola virus vaccine (Sudan and Zaire species)
    2. CAdVax-Filoviruses (Ebola )
    3. CAdVax-ZEBOV/SEBOV
    4. DNA vaccine expressing sGP
    5. Ebola virus DNA vaccine DNA/rAd5 encoding ZEBOV and SEBOV antigens
    6. Ebola virus DNA vaccine EBOV GP
    7. Ebola virus DNA vaccine encoding ZEBOV GP and SEBOV GP
    8. Ebola virus DNA vaccine GP DNA
    9. Ebola virus EBOV NP
    10. Ebola virus recombinant adenovirus vaccine AdC7-ZGP encoding GP
    11. Ebola virus recombinant adenovirus vector vaccine ADV−GP/NP
    12. Ebola virus recombinant rAD-GP encoding GP
    13. Ebola virus recombinant vector vaccine Ad-CAGoptZGP encoding the envelope glycoprotein
    14. Ebola virus recombinant vector vaccine Ad-CMVZGP encoding the glycoprotein
    15. Ebola virus recombinant vector vaccine EBO7 encoding GP from SEBOV and ZEBOV
    16. Ebola virus recombinant vector vaccine pVSVXN2∆G/ZEBOVsGP encoding GP
    17. Ebola virus recombinant VSVΔG-GP encoding GP
    18. GP and NP
    19. GP-VRP
    20. NP-VRP
    21. rAd-GP (Ebola virus)
    22. rCMV- EBOV
    23. rVEE-Ebola-NP
    24. rVSV- SEBOV-GP and -VP40
    25. rVSV-EBOV
    26. VRP expressing VP24
    27. VRP expressing VP30
    28. VRP expressing VP35
    29. VRP expressing VP40
  4. References
I. General Information
1. NCBI Taxonomy ID:
205488
2. Disease:
Ebola hemorrhagic fever
3. Introduction
Ebola virus is an aggressive pathogen that causes a highly lethal hemorrhagic fever syndrome in humans and nonhuman primates. Typically, Ebola virus infection runs its course within 14 to 21 days. Infection initially presents with nonspecific flu-like symptoms such as fever, myalgia, and malaise. As the infection progresses, patients exhibit severe bleeding and coagulation abnormalities, including gastrointestinal bleeding, rash, and a range of hematological irregularities, such as lymphopenia and neutrophilia. Cytokines are released when reticuloendothelial cells encounter virus, which can contribute to exaggerated inflammatory responses that are not protective. Damage to the liver, combined with massive viremia, leads to disseminated intravascular coagulopathy. The virus eventually infects microvascular endothelial cells and compromises vascular integrity. The terminal stages of Ebola virus infection usually include diffuse bleeding, and hypotensive shock accounts for many Ebola virus fatalities (Sullivan et al., 2003).

The Ebola virus genome is 19 kb long, with seven open reading frames encoding structural proteins, including the virion envelope glycoprotein (GP), nucleoprotein (NP), and matrix proteins VP24 and VP40; nonstructural proteins, including VP30 and VP35; and the viral polymerase. The GP open reading frame of Ebola virus gives rise to two gene products, a soluble 60- to 70-kDa protein (sGP) and a full-length 150- to 170-kDa protein (GP) that inserts into the viral membrane through transcriptional editing (Sullivan et al., 2003).
4. Microbial Pathogenesis
Mononuclear phagocytes are the first targets of infection relevant to disease pathogenesis, followed by connective tissues and parenchymal cells. Cytokines are released when reticuloendothelial cells encounter virus, which can contribute to exaggerated nonprotective inflammatory responses. Ebola virus GP plays a vital role in infection. Virual GP appears to form a trimeric complex and binds preferentially to endothelial cells Infection of endothelial cells also induces a cytopathic effect and damage to the endothelial barrier that, together with cytokine effects, leads to the loss of vascular integrity. Cytokine dysregulation and virus infection may synergize at the endothelial surface, promoting hemorrhage and vasomotor collapse. Severity of infection is influenced by age, immune status, and viral virulence. Infection with species-adapted viruses may be lethal. The amount and location of fibin deposits varies with animal species. Strains show differing levels of virulence both across species and by route of administration. Microvascular damage and activation of the clotting cascade occurs. Death is secondary to massive cell death, fluid shifts, hemorrhages, and vascular abnormalities (Sullivan et al., 2003a).

Link to pathogenesis of Ebola virus in HazARD.
5. Host Ranges and Animal Models
The natural host for Ebola virus is unknown (Sullivan et al., 2003).
6. Host Protective Immunity
Both adaptive and innate inflammatory systems respond to infection (Sullivan et al., 2003a). Although antibody titres correlate with the protective response, many studies in non-human primates have suggested that the passive transfer of antibody is insufficient to provide long-lasting protection against Ebola virus (Sullivan et al., 2003b). In rodent studies with adapted Ebola virus, passive transfer of antibodies or adoptive transfer of cytotoxic T cells showed protection when given before infection. A more sensitive but less quantitative CD4 lympho-proliferative response correlated with protection in a DNA/ADV prime–boost study. In addition to the antibody response induced by an effective vaccine, both CD4 and CD8 responses were observed after the challenge. The fact that CD4 responses were not observed before challenge whereas CD8 responses were more consistently seen beforehand suggests that the CD8 response is likely to have an important role in protection in non-human primates (Sullivan et al., 2003b).
1. EBOV NP
  • Gene Name : EBOV NP
  • Sequence Strain (Species/Organism) : Reston ebolavirus
  • VO ID : VO_0010859
  • NCBI Gene ID : 955194
  • NCBI Protein GI : 22789223
  • Locus Tag : REBOVgp1
  • Genbank Accession : AF522874
  • Protein Accession : NP_690580
  • Taxonomy ID : 186539
  • Gene Starting Position : 55
  • Gene Ending Position : 3012
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 4.69
  • Protein Weight : 80076.91
  • Protein Length : 739
  • DNA Sequence : Show Sequence
    >NC_004161.1:55-3012 Reston ebolavirus isolate Reston virus/M.fascicularis-tc/USA/1989/Philippines89-Pennsylvania, complete genome
    TGAGGAAGATTAACAGTTTTCCTCAGTTTAAGATATACACTGAAATTGAGATTGAGATTCTCCTCTTTGC
    TATTCTGTAACTTTCCCTGGTTGTGACAATTGAATCAGTTTTATCTATTACCAATTACCATCAACATGGT
    ATGTCTAGTGATCTTGGGACTCTTCTTCATCTGGTTTTTCCTAGAGCTCTGAATCCATTTTGCGAGAAGT
    TCATCCAAACGACCCAGTGTCTGAAAATACAAAAGGTTCCCCTTTCCGTCAAGTTTAAGGGGTTGTTTTG
    ATTGTGTGTAGATTTTATAATCCTAGAGTGCCAAGGAGTTGCGTGTCATCATTGATTGGGAAGATCAAGG
    AAACAATTTGTTCCAATAATATCGTACATCTTGACTAAGTCGAACAAGGGGAAGTCGATATGGATCGTGG
    GACCAGAAGAATCTGGGTGTCGCAAAATCAAGGTGATACTGATTTAGATTATCATAAAATTTTGACAGCT
    GGCCTTACTGTTCAACAGGGAATTGTCAGGCAGAAAATAATTTCTGTATATCTTGTTGATAACTTGGAGG
    CTATGTGTCAATTGGTAATACAAGCCTTTGAGGCCGGAATTGATTTCCAAGAAAATGCCGACAGCTTCCT
    TCTGATGCTTTGCCTACATCATGCTTACCAAGGTGACTATAAATTGTTCTTGGAGAGCAATGCTGTACAG
    TATTTGGAAGGTCATGGATTCAAATTTGAGCTCCGGAAGAAGGACGGTGTCAATCGGCTCGAGGAATTGC
    TTCCTGCTGCAACGAGTGGAAAAAACATCAGGCGTACGTTGGCCGCACTGCCTGAAGAGGAGACTACAGA
    AGCAAATGCAGGGCAATTTCTCTCATTTGCGAGTTTGTTTCTTCCCAAACTGGTTGTGGGAGAGAAGGCT
    TGCTTGGAAAAAGTCCAGCGACAAATTCAGGTTCATGCAGAACAGGGTTTAATTCAATATCCCACTGCAT
    GGCAATCAGTTGGACACATGATGGTAATCTTCAGATTGATGAGGACTAATTTCTTGATTAAATATTTACT
    GATCCACCAGGGTATGCATATGGTAGCTGGCCACGATGCCAATGATGCTGTCATTGCTAATTCAGTTGCT
    CAGGCTCGCTTTTCAGGACTCCTAATTGTCAAAACCGTTCTTGATCATATTCTGCAAAAAACCGACCAAG
    GAGTAAGACTTCACCCTTTGGCCCGAACAGCCAAAGTGCGTAATGAGGTTAATGCATTTAAGGCCGCCCT
    AAGCTCACTTGCTAAGCATGGGGAATATGCCCCTTTTGCTCGCCTTCTCAATCTCTCGGGAGTTAACAAC
    CTAGAACATGGTCTCTACCCACAGTTATCAGCAATTGCTCTTGGAGTTGCCACAGCACATGGTAGCACCC
    TTGCAGGAGTTAATGTTGGTGAGCAGTATCAGCAGCTTAGAGAGGCTGCCACTGAAGCTGAGAAGCAACT
    CCAACAATATGCTGAGTCCAGAGAACTCGACAGCCTAGGCCTGGACGATCAGGAAAGAAGAATACTAATG
    AACTTCCATCAGAAGAAAAACGAAATTAGTTTCCAGCAGACCAATGCAATGGTAACCCTTAGGAAAGAGC
    GACTGGCTAAATTAACAGAAGCTATAACGCTGGCCTCAAGACCTAACCTCGGGTCTAGACAAGACGACGG
    CAATGAAATACCGTTCCCTGGGCCTATAAGCAACAACCCAGACCAAGATCATCTGGAGGATGATCCTAGA
    GACTCCAGAGACACCATCATTCCTAATGGTGCAATTGACCCCGAGGATGGTGATTTTGAAAATTACAATG
    GCTATCATGATGATGAAGTTGGGACGGCAGGTGACTTGGTCCTGTTCGATCTTGACGATCATGAGGATGA
    CAATAAAGCTTTTGAGCCACAGGACAGCTCGCCACAATCCCAAAGGGAAATAGAGAGAGAAAGATTAATT
    CATCCACCCCCAGGCAACAACAAGGACGACAATCGAGCCTCAGACAACAATCAACAATCAGCAGATTCTG
    AGGAACAAGGAGGTCAATACAACTGGCACCGAGGCCCAGAACGTACGACCGCCAATCGAAGACTCTCACC
    AGTGCACGAAGAGGACACCCTTATGGATCAAGGTGATGATGATCCCTCAAGCTTACCTCCGCTGGAATCT
    GATGATGACGATGCATCAAGTAGCCAACAAGATCCCGATTATACAGCTGTTGCCCCTCCTGCTCCTGTAT
    ACCGCAGTGCAGAAGCCCACGAGCCTCCCCACAAATCCTCGAACGAGCCAGCTGAAACATCACAATTGAA
    TGAAGACCCTGATATCGGTCAATCAAAGTCTATGCAAAAATTAGAAGAGACATATCACCATCTGCTGAGA
    ACTCAAGGTCCATTTGAAGCCATCAATTATTATCACATGATGAAGGATGAGCCGGTAATATTTAGCACTG
    ATGATGGGAAGGAATACACCTACCCGGATTCACTTGAGGAAGCCTATCCTCCATGGCTCACCGAGAAAGA
    ACGACTGGACAAAGAGAATCGCTACATTTACATAAATAATCAACAGTTCTTCTGGCCTGTCATGAGTCCC
    AGAGACAAATTTCTTGCAATCTTGCAGCACCATCAGTAACCACAGCACAAAGCGCGGTCCACTTCGTAAA
    GCTAAATACACTTAAGACTTGACCGATTCATCTACAAAAACTAATCCATTATAACTTATTAGTGCTACTT
    TTCTATAAGTGATTCTTAATCTAAGGCCATTAAGAGTTTAAGTAATATACATATACACTTACACCGGTCT
    ATCCAAGATGTGGCTCAATGTTCTTGATTTGAACATAGTCATAAGGGGATAAATAATACTTTATATTTCT
    GATTGTGGATTGACCCATTCTGCTTAAAATGCTTCGCCCATTGAAAATGTGATCTAATAGATAGCCCTGA
    CTAGACAAATTAAGAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_690580.1 nucleoprotein [Reston ebolavirus]
    MDRGTRRIWVSQNQGDTDLDYHKILTAGLTVQQGIVRQKIISVYLVDNLEAMCQLVIQAFEAGIDFQENA
    DSFLLMLCLHHAYQGDYKLFLESNAVQYLEGHGFKFELRKKDGVNRLEELLPAATSGKNIRRTLAALPEE
    ETTEANAGQFLSFASLFLPKLVVGEKACLEKVQRQIQVHAEQGLIQYPTAWQSVGHMMVIFRLMRTNFLI
    KYLLIHQGMHMVAGHDANDAVIANSVAQARFSGLLIVKTVLDHILQKTDQGVRLHPLARTAKVRNEVNAF
    KAALSSLAKHGEYAPFARLLNLSGVNNLEHGLYPQLSAIALGVATAHGSTLAGVNVGEQYQQLREAATEA
    EKQLQQYAESRELDSLGLDDQERRILMNFHQKKNEISFQQTNAMVTLRKERLAKLTEAITLASRPNLGSR
    QDDGNEIPFPGPISNNPDQDHLEDDPRDSRDTIIPNGAIDPEDGDFENYNGYHDDEVGTAGDLVLFDLDD
    HEDDNKAFEPQDSSPQSQREIERERLIHPPPGNNKDDNRASDNNQQSADSEEQGGQYNWHRGPERTTANR
    RLSPVHEEDTLMDQGDDDPSSLPPLESDDDDASSSQQDPDYTAVAPPAPVYRSAEAHEPPHKSSNEPAET
    SQLNEDPDIGQSKSMQKLEETYHHLLRTQGPFEAINYYHMMKDEPVIFSTDDGKEYTYPDSLEEAYPPWL
    TEKERLDKENRYIYINNQQFFWPVMSPRDKFLAILQHHQ
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): GP-VRP , NP-VRP
2. GP from Cote d'Ivoire Ebola virus
  • Gene Name : GP from Cote d'Ivoire Ebola virus
  • Sequence Strain (Species/Organism) : Cote d'Ivoire ebolavirus
  • NCBI Gene ID : 9487535
  • NCBI Protein GI : 302315373
  • Locus Tag : CIEBOVp4
  • Genbank Accession : FJ217162
  • Protein Accession : YP_003815426
  • Taxonomy ID : 186541
  • Gene Starting Position : 5887
  • Gene Ending Position : 8292
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 6.6
  • Protein Weight : 70705.96
  • Protein Length : 676
  • Protein Note : small non-structural secreted glycoprotein; sGP
  • DNA Sequence : Show Sequence
    >gi|302315369:5887-8292 Cote d'Ivoire ebolavirus
    TGATGAAGATTAAGGCAACCAGTGGTGCTATCTTCATCTCTTTGATTTGAGTCTTAAGTGAATACACAGG
    TTCTAATACTGTTCTTCTGTCCAACGGTATAATTCAGCCAGGCCTAAGACAGTAGCTAATCACAGTCATC
    ATGGGAGCGTCAGGGATTCTGCAATTGCCCCGTGAGCGCTTCAGGAAAACATCTTTCTTTGTTTGGGTAA
    TAATCCTATTCCATAAAGTCTTTTCAATCCCGTTGGGGGTTGTACACAACAATACCCTACAAGTGAGTGA
    TATTGACAAGTTTGTGTGCCGAGACAAACTCTCTTCAACTAGCCAATTGAAGTCAGTCGGGTTGAACTTG
    GAGGGCAATGGAGTAGCAACTGATGTACCAACGGCAACCAAAAGATGGGGTTTTCGAGCTGGTGTTCCAC
    CAAAGGTGGTAAATTGCGAAGCTGGAGAATGGGCTGAGAACTGTTATAACCTGGCTATAAAGAAAGTTGA
    TGGTAGTGAGTGCCTACCAGAAGCCCCTGAGGGAGTGAGGGATTTTCCCCGTTGCCGCTATGTACACAAA
    GTCTCAGGAACTGGACCATGCCCAGGAGGACTCGCCTTTCACAAAGAAGGAGCCTTCTTCCTGTATGACC
    GACTCGCATCAACAATCATTTATCGGGGTACAACCTTTGCCGAAGGAGTTATTGCATTTCTGATCTTGCC
    TAAGGCGCGAAAGGATTTTTTCCAGTCTCCTCCATTGCATGAGCCTGCCAACATGACCACGGATCCCTCC
    AGTTACTATCACACGACAACAATAAACTACGTGGTTGATAATTTTGGAACCAACACCACAGAGTTTCTGT
    TCCAAGTCGATCATTTGACGTATGTGCAGCTCGAGGCAAGATTCACACCACAATTCCTTGTCCTCCTAAA
    TGAAACCATCTACTCTGATAACCGCAGAAGTAACACAACAGGAAAACTAATCTGGAAAATAAATCCCACT
    GTTGATACCAGCATGGGTGAGTGGGCTTTCTGGGAAAATAAAAAAACTTCACAAAAACCCTTTCAAGTGA
    AGAGTTGTCTTTCGTACCTGTACCAGAAACCCAGAACCAGGTCCTTGACACGACAGCGACGGTCTCTCCT
    CCCATCTCCGCCCACAACCACGCAGCCGAAGACCACAAAGAATTGGTTTCAGAGGATTCCACTCCAGTGG
    TTCAGATGCAAAACATCAAGGGAAAGGACACAATGCCAACCACAGTGACGGGTGTACCAACAACCACACC
    CTCTCCATTTCCAATCAATGCTCGCAACACTGATCATACCAAATCATTTATCGGCCTGGAGGGGCCCCAA
    GAAGACCACAGCACCACACAGCCTGCCAAGACCACCAGCCAACCAACCAACAGCACAGAATCGACGACAC
    TAAACCCAACATCAGAGCCCTCCAGTAGAGGCACGGGACCATCCAGCCCCACGGTCCCCAACACCACAGA
    AAGCCACGCCGAACTTGGCAAGACAACCCCAACCACACTCCCAGAACAGCACACTGCCGCCAGTGCCATT
    CCAAGAGCCGTGCACCCCGACGAACTCAGTGGACCTGGCTTCCTGACGAACACAATACGGGGGGTTACAA
    ATCTCCTGACAGGATCCAGAAGAAAGCGAAGGGATGTCACTCCCAATACACAACCCAAATGCAACCCAAA
    CCTGCACTATTGGACAGCCTTGGATGAGGGTGCTGCCATAGGTTTAGCCTGGATACCATACTTCGGGCCA
    GCAGCTGAGGGAATTTACACTGAAGGCATAATGGAGAATCAAAATGGATTGATCTGTGGATTGAGGCAGC
    TGGCCAACGAAACGACACAAGCTCTTCAATTGTTCTTAAGGGCAACTACTGAGTTGCGTACATTCTCTAT
    ACTAAATCGGAAAGCAATAGACTTCTTGCTCCAAAGATGGGGAGGAACATGTCACATTCTAGGGCCTGAT
    TGTTGCATTGAACCCCAAGATTGGACCAAAAATATCACTGATAAAATTGATCAAATAATCCATGACTTTG
    TCGATAATAATCTTCCAAATCAGAATGATGGCAGCAACTGGTGGACTGGATGGAAACAATGGGTTCCTGC
    TGGAATAGGAATCACAGGAGTAATCATTGCTATTATTGCTTTGCTGTGCATTTGCAAATTCATGCTTTGA
    ACTAATATAGCATCATACTTTCTAATATTCCCCCAATATGAATTTTTGTTTTCGATTTTATTTAATGATA
    TATCCTCTGTATACCTCACTAATGTACTCGAGCATAATTTCCCTGATAGACTTGATTGTATTTGATGATT
    AAGGACCTCACAAAATTCCTGGGGATTGAAAAGAACTGGATAACTCAATAAATTTTATGCTAGGACCACA
    AATACACTTGATGAAGATTAAGAAAA
  • Protein Sequence : Show Sequence
    >gi|302315373|ref|YP_003815426.1| spike glycoprotein precursor [Tai Forest ebolavirus]
    MGASGILQLPRERFRKTSFFVWVIILFHKVFSIPLGVVHNNTLQVSDIDKFVCRDKLSSTSQLKSVGLNL
    EGNGVATDVPTATKRWGFRAGVPPKVVNCEAGEWAENCYNLAIKKVDGSECLPEAPEGVRDFPRCRYVHK
    VSGTGPCPGGLAFHKEGAFFLYDRLASTIIYRGTTFAEGVIAFLILPKARKDFFQSPPLHEPANMTTDPS
    SYYHTTTINYVVDNFGTNTTEFLFQVDHLTYVQLEARFTPQFLVLLNETIYSDNRRSNTTGKLIWKINPT
    VDTSMGEWAFWENKKNFTKTLSSEELSFVPVPETQNQVLDTTATVSPPISAHNHAAEDHKELVSEDSTPV
    VQMQNIKGKDTMPTTVTGVPTTTPSPFPINARNTDHTKSFIGLEGPQEDHSTTQPAKTTSQPTNSTESTT
    LNPTSEPSSRGTGPSSPTVPNTTESHAELGKTTPTTLPEQHTAASAIPRAVHPDELSGPGFLTNTIRGVT
    NLLTGSRRKRRDVTPNTQPKCNPNLHYWTALDEGAAIGLAWIPYFGPAAEGIYTEGIMENQNGLICGLRQ
    LANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPQDWTKNITDKIDQIIHDF
    VDNNLPNQNDGSNWWTGWKQWVPAGIGITGVIIAIIALLCICKFML
  • Molecule Role : Other
  • Related Vaccine(s): rVSV-EBOV
3. GP from Reston ebolavirus
  • Gene Name : GP from Reston ebolavirus
  • Sequence Strain (Species/Organism) : Reston ebolavirus
  • VO ID : VO_0010858
  • NCBI Gene ID : 955190
  • NCBI Protein GI : 22789230
  • Locus Tag : REBOVgp4
  • Genbank Accession : AF522874
  • Protein Accession : NP_690583
  • Taxonomy ID : 186539
  • Gene Starting Position : 5900
  • Gene Ending Position : 8255
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 6.35
  • Protein Weight : 71040.95
  • Protein Length : 677
  • DNA Sequence : Show Sequence
    >NC_004161.1:5900-8255 Reston ebolavirus isolate Reston virus/M.fascicularis-tc/USA/1989/Philippines89-Pennsylvania, complete genome
    CGATGAAGATTAAGGCGACAACGAGCCGAAACTTCATCTCTTTTAAAGATCTAACATTATCTGTTCCAAA
    GTCATACAAGGACACATTCAAATCAGGGATTGTAAGCTGCTATTTCTTACCTCCCCAAATTACCTATACA
    ACATGGGGTCAGGATATCAACTTCTCCAATTGCCTCGGGAACGTTTTCGTAAAACTTCGTTCTTAGTATG
    GGTAATCATCCTCTTCCAGCGAGCAATCTCCATGCCGCTTGGTATAGTGACAAATAGCACTCTCAAAGCA
    ACAGAAATTGATCAATTGGTTTGTCGGGACAAACTGTCATCAACCAGTCAGCTCAAGTCTGTGGGGCTGA
    ATCTGGAAGGAAATGGAATTGCAACCGATGTCCCATCAGCAACAAAACGCTGGGGATTTCGTTCAGGTGT
    GCCTCCCAAGGTGGTCAGCTATGAAGCCGGAGAATGGGCAGAAAATTGCTACAATCTGGAGATCAAAAAG
    TCAGACGGAAGTGAATGCCTCCCTCTCCCTCCCGACGGTGTACGAGGATTCCCTAGATGTCGCTATGTCC
    ACAAAGTTCAAGGAACAGGTCCTTGTCCTGGTGACTTAGCTTTCCATAAAAATGGGGCTTTTTTCTTGTA
    TGATAGATTGGCCTCAACTGTCATCTACCGAGGGACAACTTTTGCTGAAGGTGTCGTAGCTTTTTTAATT
    CTGTCAGAGCCCAAGAAGCATTTTTGGAAGGCTACACCAGCTCATGAACCGGTGAACACAACAGATGATT
    CCACAAGCTACTACATGACCCTGACACTCAGCTACGAGATGTCAAATTTTGGGGGCAATGAAAGCAACAC
    CCTTTTTAAGGTAGACAACCACACATATGTGCAACTAGATCGTCCACACACTCCGCAGTTCCTTGTTCAG
    CTCAATGAAACACTTCGAAGAAATAATCGCCTTAGCAACAGTACAGGGAGATTGACTTGGACATTGGATC
    CTAAAATTGAACCAGATGTTGGTGAGTGGGCCTTCTGGGAAACTAAAAAAACTTTTCCCAACAACTTCAT
    GGAGAAAACTTGCATTTCCAAATTCCATCAACCCACACCAACAACTCCTCAGATCAGAGCCCGGCGGGAA
    CTGTCCAAGGAAAAATTAGCTACCACCCACCCGCCAACAACTCCGAGCTGGTTCCAACGGATTCCCCTCC
    AGTGGTTTCAGTGCTCACTGCAGGACGGACAGAGGAAATGTCGACCCAAGGTCTAACCAACGGAGAGACA
    ATCACAGGTTTCACCGCGAACCCAATGACAACCACCATTGCCCCAAGTCCAACCATGACAAGCGAGGTTG
    ATAACAATGTACCAAGTGAACAGCCGAACAACACAGCATCCATTGAAGACTCCCCCCCATCGGCAAGCAA
    CGAGACAATTTACCACTCCGAGATGGATCCGATCCAAGGCTCGAACAACTCCGCCCAGAGCCCACAGACC
    AAGACCACGCCAGCACCCACAACATCCCCGATGACCCAGGACCCGCAAGAGACGGCCAACAGCAGCAAAC
    CAGGAACCAGCCCAGGAAGCGCAGCCGGACCAAGTCAGCCCGGACTCACTATAAATACAGTAAGTAAGGT
    AGCTGATTCACTGAGTCCCACCAGGAAACAAAAGCGATCGGTTCGACAAAACACCGCTAATAAATGTAAC
    CCAGATCTTTACTATTGGACAGCTGTTGATGAGGGGGCAGCAGTAGGATTGGCATGGATTCCATATTTCG
    GACCTGCAGCAGAAGGCATCTACATTGAGGGTGTAATGCATAATCAGAATGGGCTTATTTGCGGGCTACG
    TCAGCTAGCCAATGAAACTACCCAGGCTCTTCAATTATTTCTGCGGGCCACAACAGAACTGAGGACTTAC
    TCACTTCTTAACAGAAAAGCTATTGATTTTCTTCTTCAACGATGGGGAGGTACCTGTCGAATCCTAGGAC
    CATCTTGTTGCATTGAGCCACATGATTGGACAAAAAATATTACTGATGAAATTAACCAAATTAAACATGA
    CTTTATTGACAATCCCCTACCAGACCACGGAGATGATCTTAATCTATGGACAGGTTGGAGACAATGGATC
    CCGGCTGGAATTGGGATTATTGGAGTTATAATTGCTATAATAGCCCTACTTTGTATATGTAAGATTTTGT
    GTTGATTTATTCTGAGATCTGAGAGAGAAAAATCTCAGGGTTACTCTAAGGAGAAATATTATTTTTAAAA
    TTTACTTGAATGCTGACCACTTATCTTAAATGAGCAATTAATAATATGTTTTTCTGCTTCTTTGCTTGAT
    TTACAATATGATATTTCTCTTAATAATGATTAATATATTAAGAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_690583.1 spike glycoprotein [Reston ebolavirus]
    MGSGYQLLQLPRERFRKTSFLVWVIILFQRAISMPLGIVTNSTLKATEIDQLVCRDKLSSTSQLKSVGLN
    LEGNGIATDVPSATKRWGFRSGVPPKVVSYEAGEWAENCYNLEIKKSDGSECLPLPPDGVRGFPRCRYVH
    KVQGTGPCPGDLAFHKNGAFFLYDRLASTVIYRGTTFAEGVVAFLILSEPKKHFWKATPAHEPVNTTDDS
    TSYYMTLTLSYEMSNFGGNESNTLFKVDNHTYVQLDRPHTPQFLVQLNETLRRNNRLSNSTGRLTWTLDP
    KIEPDVGEWAFWETKKNFSQQLHGENLHFQIPSTHTNNSSDQSPAGTVQGKISYHPPANNSELVPTDSPP
    VVSVLTAGRTEEMSTQGLTNGETITGFTANPMTTTIAPSPTMTSEVDNNVPSEQPNNTASIEDSPPSASN
    ETIYHSEMDPIQGSNNSAQSPQTKTTPAPTTSPMTQDPQETANSSKPGTSPGSAAGPSQPGLTINTVSKV
    ADSLSPTRKQKRSVRQNTANKCNPDLYYWTAVDEGAAVGLAWIPYFGPAAEGIYIEGVMHNQNGLICGLR
    QLANETTQALQLFLRATTELRTYSLLNRKAIDFLLQRWGGTCRILGPSCCIEPHDWTKNITDEINQIKHD
    FIDNPLPDHGDDLNLWTGWRQWIPAGIGIIGVIIAIIALLCICKILC
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): DNA vaccine expressing sGP , GP-VRP
4. GP from Sudan ebolavirus
  • Gene Name : GP from Sudan ebolavirus
  • Sequence Strain (Species/Organism) : Sudan ebolavirus
  • VO ID : VO_0010911
  • NCBI Gene ID : 3160774
  • NCBI Protein GI : 55770812
  • Locus Tag : SEVgp4
  • Genbank Accession : AY316199
  • Protein Accession : YP_138523
  • Taxonomy ID : 186540
  • Gene Starting Position : 5882
  • Gene Ending Position : 8240
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 6.35
  • Protein Weight : 71813.2
  • Protein Length : 676
  • Protein Note : forms dimers linked by disulfide bonds (parallel orientation); processed by furin to yield SGP and delta peptide
  • DNA Sequence : Show Sequence
    >NC_006432.1:5882-8240 Sudan ebolavirus isolate Sudan virus/H.sapiens-tc/UGA/2000/Gulu-808892, complete genome
    TGATGAAGATTAAGCCTGATGAAGGCCCAACCTTCATCTTTTTACCATAATCTTGTTCTCAGTACCATTT
    GATAAGGGTACACTTGCCAATACGCCCCCATCCTAAGGGTCTCGCAATGGGGGGTCTTAGCCTACTCCAA
    TTGCCCAGGGACAAATTTCGGAAAAGCTCTTTCTTTGTTTGGGTCATCATCTTATTCCAAAAGGCCTTTT
    CCATGCCTTTGGGTGTTGTGACTAACAGCACTTTAGAAGTAACAGAGATTGACCAGCTAGTCTGCAAGGA
    TCATCTTGCATCTACTGACCAGCTGAAATCAGTTGGTCTCAACCTCGAGGGGAGCGGAGTATCTACTGAT
    ATCCCATCTGCAACAAAGCGTTGGGGCTTCAGATCTGGTGTTCCTCCCAAGGTGGTCAGCTATGAAGCGG
    GAGAATGGGCTGAAAATTGCTACAATCTTGAAATAAAGAAGCCGGACGGGAGCGAATGCTTACCCCCACC
    GCCAGATGGTGTCAGAGGCTTTCCAAGGTGCCGCTATGTTCACAAAGCCCAAGGAACCGGGCCCTGCCCA
    GGTGACTACGCCTTTCACAAGGATGGAGCTTTCTTCCTCTATGACAGGCTGGCTTCAACTGTAATTTACA
    GAGGAGTCAATTTTGCTGAGGGGGTAATTGCATTCTTGATATTGGCTAAACCAAAAGAAACGTTCCTTCA
    GTCACCCCCCATTCGAGAGGCAGTAAACTACACTGAAAATACATCAAGTTATTATGCCACATCCTACTTG
    GAGTATGAAATCGAAAATTTTGGTGCTCAACACTCCACGACCCTTTTCAAAATTGACAATAATACTTTTG
    TTCGTCTGGACAGGCCCCACACGCCTCAGTTCCTTTTCCAGCTGAATGATACCATTCACCTTCACCAACA
    GTTGAGTAATACAACTGGGAGACTAATTTGGACACTAGATGCTAATATCAATGCTGATATTGGTGAATGG
    GCTTTTTGGGAAAATAAAAAAATCTCTCCGAACAACTACGTGGAGAAGAGCTGTCTTTCGAAGCTTTATC
    GCTCAACGAGACAGAAGACGATGATGCGGCATCGTCGAGAATTACAAAGGGAAGAATCTCCGACCGGGCC
    ACCAGGAAGTATTCGGACCTGGTTCCAAAGAATTCCCCTGGGATGGTTCCATTGCACATACCAGAAGGGG
    AAACAACATTGCCGTCTCAGAATTCGACAGAAGGTCGAAGAGTAGGTGTGAACACTCAGGAGACCATTAC
    AGAGACAGCTGCAACAATTATAGGCACTAACGGCAACCATATGCAGATCTCCACCATCGGGATAAGACCG
    AGCTCCAGCCAAATCCCGAGTTCCTCACCGACCACGGCACCAAGCCCTGAGGCTCAGACCCCCACAACCC
    ACACATCAGGTCCATCAGTGATGGCCACCGAGGAACCAACAACACCACCGGGAAGCTCCCCCGGCCCAAC
    AACAGAAGCACCCACTCTCACCACCCCAGAAAATATAACAACAGCGGTTAAAACTGTCCTGCCACAGGAG
    TCCACAAGCAACGGTCTAATAACTTCAACAGTAACAGGGATTCTTGGGAGTCTTGGGCTTCGAAAACGCA
    GCAGAAGACAAACTAACACCAAAGCCACGGGTAAGTGCAATCCCAACTTACACTACTGGACTGCACAAGA
    ACAACATAATGCTGCTGGGATTGCCTGGATCCCGTACTTTGGACCGGGTGCGGAAGGCATATACACTGAA
    GGCCTGATGCATAACCAAAATGCCTTAGTCTGTGGACTTAGGCAACTTGCAAATGAAACAACTCAAGCTC
    TGCAGCTTTTCTTAAGAGCCACAACGGAGCTGCGGACATATACCATACTCAATAGGAAGGCCATAGATTT
    CCTTCTGCGACGATGGGGCGGGACATGCAGGATCCTGGGACCAGATTGTTGCATTGAGCCACATGATTGG
    ACAAAAAACATCACTGATAAAATCAACCAAATCATCCATGATTTCATCGACAACCCCTTACCTAATCAGG
    ATAATGATGATAATTGGTGGACGGGCTGGAGACAGTGGATCCCTGCAGGAATAGGCATTACTGGAATTAT
    TATTGCAATTATTGCTCTTCTTTGCGTTTGCAAGCTGCTTTGCTGAATATCAATTTGAATCATCAATTTA
    AGCTTGATACATTTCTAGCATTTTAAATTATAAACCGATACTGATACTTGAAAATCAGGCTAATGCCAAG
    TTCTGTGCAAAACTTGAAAGTAGGTTTACAAAAATCCTTTGGACTGGAATGCTTTGATACTCTTTCTCAA
    TACTATATAAGTTCCTTCCCAAGAATAATATTGATGAAGATTAAGAAAA
    
    
  • Protein Sequence : Show Sequence
    >YP_138523.1 spike glycoprotein [Sudan ebolavirus]
    MGGLSLLQLPRDKFRKSSFFVWVIILFQKAFSMPLGVVTNSTLEVTEIDQLVCKDHLASTDQLKSVGLNL
    EGSGVSTDIPSATKRWGFRSGVPPKVVSYEAGEWAENCYNLEIKKPDGSECLPPPPDGVRGFPRCRYVHK
    AQGTGPCPGDYAFHKDGAFFLYDRLASTVIYRGVNFAEGVIAFLILAKPKETFLQSPPIREAVNYTENTS
    SYYATSYLEYEIENFGAQHSTTLFKIDNNTFVRLDRPHTPQFLFQLNDTIHLHQQLSNTTGRLIWTLDAN
    INADIGEWAFWENKKNLSEQLRGEELSFEALSLNETEDDDAASSRITKGRISDRATRKYSDLVPKNSPGM
    VPLHIPEGETTLPSQNSTEGRRVGVNTQETITETAATIIGTNGNHMQISTIGIRPSSSQIPSSSPTTAPS
    PEAQTPTTHTSGPSVMATEEPTTPPGSSPGPTTEAPTLTTPENITTAVKTVLPQESTSNGLITSTVTGIL
    GSLGLRKRSRRQTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQ
    LANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDF
    IDNPLPNQDNDDNWWTGWRQWIPAGIGITGIIIAIIALLCVCKLLC
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Cynomolgus macaques were immunized with DNA/rAd5 vaccines expressing ZEBOV (GP) and SEBOV glycoprotein (GP) prior to lethal challenge with BEBOV. Vaccinated subjects developed robust, antigen-specific humoral and cellular immune responses against the GP from ZEBOV as well as cellular immunity against BEBOV GP, and immunized macaques were uniformly protected against lethal challenge with BEBOV (Hensley et al., 2010).
  • Related Vaccine(s): cAdVax-based bivalent ebola virus vaccine (Sudan and Zaire species) , CAdVax-ZEBOV/SEBOV , Ebola virus DNA vaccine DNA/rAd5 encoding ZEBOV and SEBOV antigens , Ebola virus DNA vaccine encoding ZEBOV GP and SEBOV GP , Ebola virus recombinant vector vaccine EBO7 encoding GP from SEBOV and ZEBOV
5. GP from Zaire ebolavirus
  • Gene Name : GP from Zaire ebolavirus
  • Sequence Strain (Species/Organism) : Zaire ebolavirus
  • VO ID : VO_0010910
  • NCBI Gene ID : 911829
  • NCBI Protein GI : 10313995
  • Locus Tag : ZEBOVgp4
  • Genbank Accession : AF272001
  • Protein Accession : NP_066246
  • Taxonomy ID : 186538
  • Gene Starting Position : 5899
  • Gene Ending Position : 8304
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 6.6
  • Protein Weight : 70989.69
  • Protein Length : 676
  • Protein Note : sGP secreted as a anti-parallel oriented homodimer
  • DNA Sequence : Show Sequence
    >NC_002549.1:5899-8304 Zaire ebolavirus isolate Ebola virus/H.sapiens-tc/COD/1976/Yambuku-Mayinga, complete genome
    CGATGAAGATTAAGCCGACAGTGAGCGTAATCTTCATCTCTCTTAGATTATTTGTTTTCCAGAGTAGGGG
    TCGTCAGGTCCTTTTCAATCGTGTAACCAAAATAAACTCCACTAGAAGGATATTGTGGGGCAACAACACA
    ATGGGCGTTACAGGAATATTGCAGTTACCTCGTGATCGATTCAAGAGGACATCATTCTTTCTTTGGGTAA
    TTATCCTTTTCCAAAGAACATTTTCCATCCCACTTGGAGTCATCCACAATAGCACATTACAGGTTAGTGA
    TGTCGACAAACTAGTTTGTCGTGACAAACTGTCATCCACAAATCAATTGAGATCAGTTGGACTGAATCTC
    GAAGGGAATGGAGTGGCAACTGACGTGCCATCTGCAACTAAAAGATGGGGCTTCAGGTCCGGTGTCCCAC
    CAAAGGTGGTCAATTATGAAGCTGGTGAATGGGCTGAAAACTGCTACAATCTTGAAATCAAAAAACCTGA
    CGGGAGTGAGTGTCTACCAGCAGCGCCAGACGGGATTCGGGGCTTCCCCCGGTGCCGGTATGTGCACAAA
    GTATCAGGAACGGGACCGTGTGCCGGAGACTTTGCCTTCCATAAAGAGGGTGCTTTCTTCCTGTATGATC
    GACTTGCTTCCACAGTTATCTACCGAGGAACGACTTTCGCTGAAGGTGTCGTTGCATTTCTGATACTGCC
    CCAAGCTAAGAAGGACTTCTTCAGCTCACACCCCTTGAGAGAGCCGGTCAATGCAACGGAGGACCCGTCT
    AGTGGCTACTATTCTACCACAATTAGATATCAGGCTACCGGTTTTGGAACCAATGAGACAGAGTACTTGT
    TCGAGGTTGACAATTTGACCTACGTCCAACTTGAATCAAGATTCACACCACAGTTTCTGCTCCAGCTGAA
    TGAGACAATATATACAAGTGGGAAAAGGAGCAATACCACGGGAAAACTAATTTGGAAGGTCAACCCCGAA
    ATTGATACAACAATCGGGGAGTGGGCCTTCTGGGAAACTAAAAAAACCTCACTAGAAAAATTCGCAGTGA
    AGAGTTGTCTTTCACAGTTGTATCAAACGGAGCCAAAAACATCAGTGGTCAGAGTCCGGCGCGAACTTCT
    TCCGACCCAGGGACCAACACAACAACTGAAGACCACAAAATCATGGCTTCAGAAAATTCCTCTGCAATGG
    TTCAAGTGCACAGTCAAGGAAGGGAAGCTGCAGTGTCGCATCTAACAACCCTTGCCACAATCTCCACGAG
    TCCCCAATCCCTCACAACCAAACCAGGTCCGGACAACAGCACCCATAATACACCCGTGTATAAACTTGAC
    ATCTCTGAGGCAACTCAAGTTGAACAACATCACCGCAGAACAGACAACGACAGCACAGCCTCCGACACTC
    CCTCTGCCACGACCGCAGCCGGACCCCCAAAAGCAGAGAACACCAACACGAGCAAGAGCACTGACTTCCT
    GGACCCCGCCACCACAACAAGTCCCCAAAACCACAGCGAGACCGCTGGCAACAACAACACTCATCACCAA
    GATACCGGAGAAGAGAGTGCCAGCAGCGGGAAGCTAGGCTTAATTACCAATACTATTGCTGGAGTCGCAG
    GACTGATCACAGGCGGGAGAAGAACTCGAAGAGAAGCAATTGTCAATGCTCAACCCAAATGCAACCCTAA
    TTTACATTACTGGACTACTCAGGATGAAGGTGCTGCAATCGGACTGGCCTGGATACCATATTTCGGGCCA
    GCAGCCGAGGGAATTTACATAGAGGGGCTAATGCACAATCAAGATGGTTTAATCTGTGGGTTGAGACAGC
    TGGCCAACGAGACGACTCAAGCTCTTCAACTGTTCCTGAGAGCCACAACTGAGCTACGCACCTTTTCAAT
    CCTCAACCGTAAGGCAATTGATTTCTTGCTGCAGCGATGGGGCGGCACATGCCACATTCTGGGACCGGAC
    TGCTGTATCGAACCACATGATTGGACCAAGAACATAACAGACAAAATTGATCAGATTATTCATGATTTTG
    TTGATAAAACCCTTCCGGACCAGGGGGACAATGACAATTGGTGGACAGGATGGAGACAATGGATACCGGC
    AGGTATTGGAGTTACAGGCGTTATAATTGCAGTTATCGCTTTATTCTGTATATGCAAATTTGTCTTTTAG
    TTTTTCTTCAGATTGCTTCATGGAAAAGCTCAGCCTCAAATCAATGAAACCAGGATTTAATTATATGGAT
    TACTTGAATCTAAGATTACTTGACAAATGATAATATAATACACTGGAGCTTTAAACATAGCCAATGTGAT
    TCTAACTCCTTTAAACTCACAGTTAATCATAAACAAGGTTTGACATCAATCTAGTTATCTCTTTGAGAAT
    GATAAACTTGATGAAGATTAAGAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_066246.1 spike glycoprotein [Zaire ebolavirus]
    MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSVGLNL
    EGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHK
    VSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPS
    SGYYSTTIRYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYTSGKRSNTTGKLIWKVNPE
    IDTTIGEWAFWETKKNLTRKIRSEELSFTVVSNGAKNISGQSPARTSSDPGTNTTTEDHKIMASENSSAM
    VQVHSQGREAAVSHLTTLATISTSPQSLTTKPGPDNSTHNTPVYKLDISEATQVEQHHRRTDNDSTASDT
    PSATTAAGPPKAENTNTSKSTDFLDPATTTSPQNHSETAGNNNTHHQDTGEESASSGKLGLITNTIAGVA
    GLITGGRRTRREAIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYIEGLMHNQDGLICGLRQ
    LANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKIDQIIHDF
    VDKTLPDQGDNDNWWTGWRQWIPAGIGVTGVIIAVIALFCICKFVF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Cynomolgus macaques were immunized with DNA/rAd5 vaccines expressing ZEBOV (GP) and SEBOV glycoprotein (GP) prior to lethal challenge with BEBOV. Vaccinated subjects developed robust, antigen-specific humoral and cellular immune responses against the GP from ZEBOV as well as cellular immunity against BEBOV GP, and immunized macaques were uniformly protected against lethal challenge with BEBOV (Hensley et al., 2010).
  • Related Vaccine(s): cAdVax-based bivalent ebola virus vaccine (Sudan and Zaire species) , CAdVax-ZEBOV/SEBOV , Ebola virus DNA vaccine DNA/rAd5 encoding ZEBOV and SEBOV antigens , Ebola virus DNA vaccine EBOV GP , Ebola virus DNA vaccine encoding ZEBOV GP and SEBOV GP , Ebola virus DNA vaccine GP DNA , Ebola virus recombinant adenovirus vaccine AdC7-ZGP encoding GP , Ebola virus recombinant adenovirus vector vaccine ADV−GP/NP , Ebola virus recombinant rAD-GP encoding GP , Ebola virus recombinant vector vaccine Ad-CAGoptZGP encoding the envelope glycoprotein , Ebola virus recombinant vector vaccine Ad-CMVZGP encoding the glycoprotein , Ebola virus recombinant vector vaccine EBO7 encoding GP from SEBOV and ZEBOV , Ebola virus recombinant vector vaccine pVSVXN2∆G/ZEBOVsGP encoding GP , Ebola virus recombinant VSVΔG-GP encoding GP , rAd-GP (Ebola virus) , rVSV-EBOV
6. NP
  • Gene Name : NP
  • Sequence Strain (Species/Organism) : Zaire ebolavirus
  • VO ID : VO_0010912
  • NCBI Gene ID : 911830
  • NCBI Protein GI : 10314000
  • Locus Tag : ZEBOVgp1
  • Genbank Accession : AY142960
  • Protein Accession : NP_066243
  • Taxonomy ID : 186538
  • Gene Starting Position : 55
  • Gene Ending Position : 3025
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 4.77
  • Protein Weight : 79118.19
  • Protein Length : 739
  • DNA Sequence : Show Sequence
    >NC_002549.1:55-3025 Zaire ebolavirus isolate Ebola virus/H.sapiens-tc/COD/1976/Yambuku-Mayinga, complete genome
    TGAGGAAGATTAATAATTTTCCTCTCATTGAAATTTATATCGGAATTTAAATTGAAATTGTTACTGTAAT
    CACACCTGGTTTGTTTCAGAGCCACATCACAAAGATAGAGAACAACCTAGGTCTCCGAAGGGAGCAAGGG
    CATCAGTGTGCTCAGTTGAAAATCCCTTGTCAACACCTAGGTCTTATCACATCACAAGTTCCACCTCAGA
    CTCTGCAGGGTGATCCAACAACCTTAATAGAAACATTATTGTTAAAGGACAGCATTAGTTCACAGTCAAA
    CAAGCAAGATTGAGAATTAACCTTGGTTTTGAACTTGAACACTTAGGGGATTGAAGATTCAACAACCCTA
    AAGCTTGGGGTAAAACATTGGAAATAGTTAAAAGACAAATTGCTCGGAATCACAAAATTCCGAGTATGGA
    TTCTCGTCCTCAGAAAATCTGGATGGCGCCGAGTCTCACTGAATCTGACATGGATTACCACAAGATCTTG
    ACAGCAGGTCTGTCCGTTCAACAGGGGATTGTTCGGCAAAGAGTCATCCCAGTGTATCAAGTAAACAATC
    TTGAAGAAATTTGCCAACTTATCATACAGGCCTTTGAAGCAGGTGTTGATTTTCAAGAGAGTGCGGACAG
    TTTCCTTCTCATGCTTTGTCTTCATCATGCGTACCAGGGAGATTACAAACTTTTCTTGGAAAGTGGCGCA
    GTCAAGTATTTGGAAGGGCACGGGTTCCGTTTTGAAGTCAAGAAGCGTGATGGAGTGAAGCGCCTTGAGG
    AATTGCTGCCAGCAGTATCTAGTGGAAAAAACATTAAGAGAACACTTGCTGCCATGCCGGAAGAGGAGAC
    AACTGAAGCTAATGCCGGTCAGTTTCTCTCCTTTGCAAGTCTATTCCTTCCGAAATTGGTAGTAGGAGAA
    AAGGCTTGCCTTGAGAAGGTTCAAAGGCAAATTCAAGTACATGCAGAGCAAGGACTGATACAATATCCAA
    CAGCTTGGCAATCAGTAGGACACATGATGGTGATTTTCCGTTTGATGCGAACAAATTTTCTGATCAAATT
    TCTCCTAATACACCAAGGGATGCACATGGTTGCCGGGCATGATGCCAACGATGCTGTGATTTCAAATTCA
    GTGGCTCAAGCTCGTTTTTCAGGCTTATTGATTGTCAAAACAGTACTTGATCATATCCTACAAAAGACAG
    AACGAGGAGTTCGTCTCCATCCTCTTGCAAGGACCGCCAAGGTAAAAAATGAGGTGAACTCCTTTAAGGC
    TGCACTCAGCTCCCTGGCCAAGCATGGAGAGTATGCTCCTTTCGCCCGACTTTTGAACCTTTCTGGAGTA
    AATAATCTTGAGCATGGTCTTTTCCCTCAACTATCGGCAATTGCACTCGGAGTCGCCACAGCACACGGGA
    GTACCCTCGCAGGAGTAAATGTTGGAGAACAGTATCAACAACTCAGAGAGGCTGCCACTGAGGCTGAGAA
    GCAACTCCAACAATATGCAGAGTCTCGCGAACTTGACCATCTTGGACTTGATGATCAGGAAAAGAAAATT
    CTTATGAACTTCCATCAGAAAAAGAACGAAATCAGCTTCCAGCAAACAAACGCTATGGTAACTCTAAGAA
    AAGAGCGCCTGGCCAAGCTGACAGAAGCTATCACTGCTGCGTCACTGCCCAAAACAAGTGGACATTACGA
    TGATGATGACGACATTCCCTTTCCAGGACCCATCAATGATGACGACAATCCTGGCCATCAAGATGATGAT
    CCGACTGACTCACAGGATACGACCATTCCCGATGTGGTGGTTGATCCCGATGATGGAAGCTACGGCGAAT
    ACCAGAGTTACTCGGAAAACGGCATGAATGCACCAGATGACTTGGTCCTATTCGATCTAGACGAGGACGA
    CGAGGACACTAAGCCAGTGCCTAATAGATCGACCAAGGGTGGACAACAGAAGAACAGTCAAAAGGGCCAG
    CATATAGAGGGCAGACAGACACAATCCAGGCCAATTCAAAATGTCCCAGGCCCTCACAGAACAATCCACC
    ACGCCAGTGCGCCACTCACGGACAATGACAGAAGAAATGAACCCTCCGGCTCAACCAGCCCTCGCATGCT
    GACACCAATTAACGAAGAGGCAGACCCACTGGACGATGCCGACGACGAGACGTCTAGCCTTCCGCCCTTG
    GAGTCAGATGATGAAGAGCAGGACAGGGACGGAACTTCCAACCGCACACCCACTGTCGCCCCACCGGCTC
    CCGTATACAGAGATCACTCTGAAAAGAAAGAACTCCCGCAAGACGAGCAACAAGATCAGGACCACACTCA
    AGAGGCCAGGAACCAGGACAGTGACAACACCCAGTCAGAACACTCTTTTGAGGAGATGTATCGCCACATT
    CTAAGATCACAGGGGCCATTTGATGCTGTTTTGTATTATCATATGATGAAGGATGAGCCTGTAGTTTTCA
    GTACCAGTGATGGCAAAGAGTACACGTATCCAGACTCCCTTGAAGAGGAATATCCACCATGGCTCACTGA
    AAAAGAGGCTATGAATGAAGAGAATAGATTTGTTACATTGGATGGTCAACAATTTTATTGGCCGGTGATG
    AATCACAAGAATAAATTCATGGCAATCCTGCAACATCATCAGTGAATGAGCATGGAACAATGGGATGATT
    CAACCGACAAATAGCTAACATTAAGTAGTCAAGGAACGAAAACAGGAAGAATTTTTGATGTCTAAGGTGT
    GAATTATTATCACAATAAAAGTGATTCTTATTTTTGAATTTAAAGCTAGCTTATTATTACTAGCCGTTTT
    TCAAAGTTCAATTTGAGTCTTAATGCAAATAGGCGTTAAGCCACAGTTATAGCCATAATTGTAACTCAAT
    ATTCTAACTAGCGATTTATCTAAATTAAATTACATTATGCTTTTATAACTTACCTACTAGCCTGCCCAAC
    ATTTACACGATCGTTTTATAATTAAGAAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_066243.1 nucleoprotein [Zaire ebolavirus]
    MDSRPQKIWMAPSLTESDMDYHKILTAGLSVQQGIVRQRVIPVYQVNNLEEICQLIIQAFEAGVDFQESA
    DSFLLMLCLHHAYQGDYKLFLESGAVKYLEGHGFRFEVKKRDGVKRLEELLPAVSSGKNIKRTLAAMPEE
    ETTEANAGQFLSFASLFLPKLVVGEKACLEKVQRQIQVHAEQGLIQYPTAWQSVGHMMVIFRLMRTNFLI
    KFLLIHQGMHMVAGHDANDAVISNSVAQARFSGLLIVKTVLDHILQKTERGVRLHPLARTAKVKNEVNSF
    KAALSSLAKHGEYAPFARLLNLSGVNNLEHGLFPQLSAIALGVATAHGSTLAGVNVGEQYQQLREAATEA
    EKQLQQYAESRELDHLGLDDQEKKILMNFHQKKNEISFQQTNAMVTLRKERLAKLTEAITAASLPKTSGH
    YDDDDDIPFPGPINDDDNPGHQDDDPTDSQDTTIPDVVVDPDDGSYGEYQSYSENGMNAPDDLVLFDLDE
    DDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPR
    MLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDH
    TQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWL
    TEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Guinea pigs infected with a single intranasal inoculation of HPIV3/EboGP-NP showed no apparent signs of disease yet developed a strong humoral response specific to the EV proteins. When these animals were challenged with an intraperitoneal injection of 10(3) PFU of EV, there were no outward signs of disease, no viremia or detectable EV antigen in the blood, and no evidence of infection in the spleen, liver, and lungs. In contrast, all of the control animals died or developed severe EV disease following challenge (Bukreyev et al., 2006).
7. NP from Zaire Ebola virus
  • Gene Name : NP from Zaire Ebola virus
  • Sequence Strain (Species/Organism) : Ebola virus - Mayinga, Zaire, 1976
  • NCBI Gene ID : 911830
  • NCBI Protein GI : 10314000
  • Locus Tag : ZEBOVgp1
  • Genbank Accession : AF086833
  • Protein Accession : NP_066243
  • Taxonomy ID : 128952
  • Gene Starting Position : 55
  • Gene Ending Position : 3025
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 4.77
  • Protein Weight : 79118.19
  • Protein Length : 739
  • DNA Sequence : Show Sequence
    >gi|10313991:55-3025 Ebola virus - Mayinga, Zaire, 1976 strain Mayinga
    TGAGGAAGATTAATAATTTTCCTCTCATTGAAATTTATATCGGAATTTAAATTGAAATTGTTACTGTAAT
    CACACCTGGTTTGTTTCAGAGCCACATCACAAAGATAGAGAACAACCTAGGTCTCCGAAGGGAGCAAGGG
    CATCAGTGTGCTCAGTTGAAAATCCCTTGTCAACACCTAGGTCTTATCACATCACAAGTTCCACCTCAGA
    CTCTGCAGGGTGATCCAACAACCTTAATAGAAACATTATTGTTAAAGGACAGCATTAGTTCACAGTCAAA
    CAAGCAAGATTGAGAATTAACCTTGGTTTTGAACTTGAACACTTAGGGGATTGAAGATTCAACAACCCTA
    AAGCTTGGGGTAAAACATTGGAAATAGTTAAAAGACAAATTGCTCGGAATCACAAAATTCCGAGTATGGA
    TTCTCGTCCTCAGAAAATCTGGATGGCGCCGAGTCTCACTGAATCTGACATGGATTACCACAAGATCTTG
    ACAGCAGGTCTGTCCGTTCAACAGGGGATTGTTCGGCAAAGAGTCATCCCAGTGTATCAAGTAAACAATC
    TTGAAGAAATTTGCCAACTTATCATACAGGCCTTTGAAGCAGGTGTTGATTTTCAAGAGAGTGCGGACAG
    TTTCCTTCTCATGCTTTGTCTTCATCATGCGTACCAGGGAGATTACAAACTTTTCTTGGAAAGTGGCGCA
    GTCAAGTATTTGGAAGGGCACGGGTTCCGTTTTGAAGTCAAGAAGCGTGATGGAGTGAAGCGCCTTGAGG
    AATTGCTGCCAGCAGTATCTAGTGGAAAAAACATTAAGAGAACACTTGCTGCCATGCCGGAAGAGGAGAC
    AACTGAAGCTAATGCCGGTCAGTTTCTCTCCTTTGCAAGTCTATTCCTTCCGAAATTGGTAGTAGGAGAA
    AAGGCTTGCCTTGAGAAGGTTCAAAGGCAAATTCAAGTACATGCAGAGCAAGGACTGATACAATATCCAA
    CAGCTTGGCAATCAGTAGGACACATGATGGTGATTTTCCGTTTGATGCGAACAAATTTTCTGATCAAATT
    TCTCCTAATACACCAAGGGATGCACATGGTTGCCGGGCATGATGCCAACGATGCTGTGATTTCAAATTCA
    GTGGCTCAAGCTCGTTTTTCAGGCTTATTGATTGTCAAAACAGTACTTGATCATATCCTACAAAAGACAG
    AACGAGGAGTTCGTCTCCATCCTCTTGCAAGGACCGCCAAGGTAAAAAATGAGGTGAACTCCTTTAAGGC
    TGCACTCAGCTCCCTGGCCAAGCATGGAGAGTATGCTCCTTTCGCCCGACTTTTGAACCTTTCTGGAGTA
    AATAATCTTGAGCATGGTCTTTTCCCTCAACTATCGGCAATTGCACTCGGAGTCGCCACAGCACACGGGA
    GTACCCTCGCAGGAGTAAATGTTGGAGAACAGTATCAACAACTCAGAGAGGCTGCCACTGAGGCTGAGAA
    GCAACTCCAACAATATGCAGAGTCTCGCGAACTTGACCATCTTGGACTTGATGATCAGGAAAAGAAAATT
    CTTATGAACTTCCATCAGAAAAAGAACGAAATCAGCTTCCAGCAAACAAACGCTATGGTAACTCTAAGAA
    AAGAGCGCCTGGCCAAGCTGACAGAAGCTATCACTGCTGCGTCACTGCCCAAAACAAGTGGACATTACGA
    TGATGATGACGACATTCCCTTTCCAGGACCCATCAATGATGACGACAATCCTGGCCATCAAGATGATGAT
    CCGACTGACTCACAGGATACGACCATTCCCGATGTGGTGGTTGATCCCGATGATGGAAGCTACGGCGAAT
    ACCAGAGTTACTCGGAAAACGGCATGAATGCACCAGATGACTTGGTCCTATTCGATCTAGACGAGGACGA
    CGAGGACACTAAGCCAGTGCCTAATAGATCGACCAAGGGTGGACAACAGAAGAACAGTCAAAAGGGCCAG
    CATATAGAGGGCAGACAGACACAATCCAGGCCAATTCAAAATGTCCCAGGCCCTCACAGAACAATCCACC
    ACGCCAGTGCGCCACTCACGGACAATGACAGAAGAAATGAACCCTCCGGCTCAACCAGCCCTCGCATGCT
    GACACCAATTAACGAAGAGGCAGACCCACTGGACGATGCCGACGACGAGACGTCTAGCCTTCCGCCCTTG
    GAGTCAGATGATGAAGAGCAGGACAGGGACGGAACTTCCAACCGCACACCCACTGTCGCCCCACCGGCTC
    CCGTATACAGAGATCACTCTGAAAAGAAAGAACTCCCGCAAGACGAGCAACAAGATCAGGACCACACTCA
    AGAGGCCAGGAACCAGGACAGTGACAACACCCAGTCAGAACACTCTTTTGAGGAGATGTATCGCCACATT
    CTAAGATCACAGGGGCCATTTGATGCTGTTTTGTATTATCATATGATGAAGGATGAGCCTGTAGTTTTCA
    GTACCAGTGATGGCAAAGAGTACACGTATCCAGACTCCCTTGAAGAGGAATATCCACCATGGCTCACTGA
    AAAAGAGGCTATGAATGAAGAGAATAGATTTGTTACATTGGATGGTCAACAATTTTATTGGCCGGTGATG
    AATCACAAGAATAAATTCATGGCAATCCTGCAACATCATCAGTGAATGAGCATGGAACAATGGGATGATT
    CAACCGACAAATAGCTAACATTAAGTAGTCAAGGAACGAAAACAGGAAGAATTTTTGATGTCTAAGGTGT
    GAATTATTATCACAATAAAAGTGATTCTTATTTTTGAATTTAAAGCTAGCTTATTATTACTAGCCGTTTT
    TCAAAGTTCAATTTGAGTCTTAATGCAAATAGGCGTTAAGCCACAGTTATAGCCATAATTGTAACTCAAT
    ATTCTAACTAGCGATTTATCTAAATTAAATTACATTATGCTTTTATAACTTACCTACTAGCCTGCCCAAC
    ATTTACACGATCGTTTTATAATTAAGAAAAA
  • Protein Sequence : Show Sequence
    >gi|10314000|ref|NP_066243.1| NP gene product [Ebola virus - Mayinga, Zaire, 1976]
    MDSRPQKIWMAPSLTESDMDYHKILTAGLSVQQGIVRQRVIPVYQVNNLEEICQLIIQAFEAGVDFQESA
    DSFLLMLCLHHAYQGDYKLFLESGAVKYLEGHGFRFEVKKRDGVKRLEELLPAVSSGKNIKRTLAAMPEE
    ETTEANAGQFLSFASLFLPKLVVGEKACLEKVQRQIQVHAEQGLIQYPTAWQSVGHMMVIFRLMRTNFLI
    KFLLIHQGMHMVAGHDANDAVISNSVAQARFSGLLIVKTVLDHILQKTERGVRLHPLARTAKVKNEVNSF
    KAALSSLAKHGEYAPFARLLNLSGVNNLEHGLFPQLSAIALGVATAHGSTLAGVNVGEQYQQLREAATEA
    EKQLQQYAESRELDHLGLDDQEKKILMNFHQKKNEISFQQTNAMVTLRKERLAKLTEAITAASLPKTSGH
    YDDDDDIPFPGPINDDDNPGHQDDDPTDSQDTTIPDVVVDPDDGSYGEYQSYSENGMNAPDDLVLFDLDE
    DDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPR
    MLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDH
    TQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWL
    TEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ
  • Molecule Role : Other
  • Related Vaccine(s): Ebola virus EBOV NP , Ebola virus recombinant adenovirus vector vaccine ADV−GP/NP , rCMV- EBOV , rVEE-Ebola-NP , rVSV- SEBOV-GP and -VP40
8. pagA
  • Gene Name : pagA
  • Sequence Strain (Species/Organism) : Bacillus anthracis
  • NCBI Protein GI : BAD14937
  • Other Database IDs : CDD:281492
  • Taxonomy ID : 1392
  • Protein Name : pagA
  • Protein pI : 6.4
  • Protein Weight : 24803.18
  • Protein Length : 302
  • Protein Note : a partial cDNA fragment of pag gene generated a Eco RV site in the middle of the sequence by the overlap extension PCR
  • Protein Sequence : Show Sequence
    >BAD14937.1 pagA, partial (plasmid) [Bacillus anthracis]
    KRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSD
    FEKVTGRIDKNVSPEARHPLVAAYPIVHVDIENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHG
    NAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARLNADIRYVNTGTAPIY
    NVLPTTSLVLGKNQTLATIKAKENQLSQIL
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Garufi et al., 2012)
9. SGP
  • Gene Name : SGP
  • Sequence Strain (Species/Organism) : Sudan ebolavirus strain Boniface
  • NCBI Nucleotide GI : 1041223
  • NCBI Protein GI : 1041225
  • Protein Accession : AAB37096.1
  • Other Database IDs : CDD:279888
    CDD:197367
  • Taxonomy ID : 186540
  • Gene Strand (Orientation) : ?
  • Protein Name : virion spike glycoprotein precursor
  • Protein pI : 5.67
  • Protein Weight : 72335.57
  • Protein Length : 754
  • Protein Note : subtype: Sudan
  • DNA Sequence : Show Sequence
    >gi|1041223|gb|U28134.1|EVU28134 Sudan Ebola virus strain Boniface virion spike glycoprotein (SP) gene, complete cds, and small/secreted glycoprotein precursor (SGP) gene, complete cds
    ATTTGATGAAGATTAAGCCTGATTAAGGCCCAACCTTCATCTTTTTACCATAATCTTGTTCTCAATACCA
    TTTAATAGGGGTATACTTGCCAAAGCGCCCCCATCCTCAGGATCTCGCAATGGAGGGTCTTAGCCTACTC
    CAATTGCCCAGAGATAAATTTCGAAAAAGCTCTTTCTTTGTTTGGGTCATCATCTTATTTCAAAAGGCCT
    TTTCCATGCCTTTGGGTGTTGTGACCAACAGCACTTTAGAAGTAACAGAGATTGACCAGCTAGTCTGCAA
    GGATCATCTTGCATCAACTGACCAGCTGAAATCAGTTGGTCTCAACCTCGAGGGGAGCGGAGTATCTACT
    GATATCCCATCTGCGACAAAGCGTTGGGGCTTCAGATCTGGTGTGCCTCCCCAAGTGGTCAGCTATGAAG
    CAGGAGAATGGGCTGAAAATTGCTACAATCTTGAAATAAAGAAACCGGACGGGAGCGAATGCTTACCCCC
    ACCGCCGGATGGTGTCAGAGGCTTTCCAAGGTGCCGCTATGTTCACAAAGCCCAAGGAACCGGGCCCTGC
    CCGGGTGACTATGCCTTTCACAAGGATGGAGCTTTCTTCCTCTATGACAGGCTGGCTTCAACTGTAATTT
    ACAGAGGAGTCAATTTTGCTGAGGGGGTAATCGCATTCTTGATATTGGCTAAACCAAAGGAAACGTTCCT
    TCAATCACCCCCCATTCGAGAGGCAGCAAACTACACTGAAAATACATCAAGTTACTATGCCACATCCTAC
    TTGGAGTACGAAATCGAAAATTTTGGTGCTCAACACTCCACGACCCTTTTCAAAATTAACAATAATACTT
    TTGTTCTTCTGGACAGGCCCCACACGCCTCAGTTCCTTTTCCAGCTGAATGATACCATTCAACTTCACCA
    ACAGTTGAGCAACACAACTGGGAAACTAATTTGGACACTAGATGCTAATATCAATGCTGATATTGGTGAA
    TGGGCTTTTTGGGAAAATAAAAAAATCTCTCCGAACAACTACGTGGAGAAGAGCTGTCTTTCGAAACTTT
    ATCGCTCAACGAGACAGAAGACGATGATGCGACATCGTCGAGAACTACAAAGGGAAGAATCTCCGACCGG
    GCCACCAGGAAGTATTCGGACCTGGTTCCAAAGGATTCCCCTGGGATGGTTTCATTGCACGTACCAGAAG
    GGGAAACAACATTGCCGTCTCAGAATTCGACAGAAGGTCGAAGAGTAGATGTGAATACTCAGGAAACTAT
    CACAGAGACAACTGCAACAATCATAGGCACTAACGGTAACAACATGCAGATCTCCACCATCGGGACAGGA
    CTGAGCTCCAGCCAAATCCTGAGTTCCTCACCGACCATGGCACCAAGCCCTGAGACTCAGACCTCCACAA
    CCTACACACCAAAACTACCAGTGATGACCACCGAGGAATCAACAACACCACCGAGAAACTCTCCTGGCTC
    AACAACAGAAGCACCCACTCTCACCACCCCAGAGAATATAACAACAGCGGTTAAAACTGTTTGGCCACAA
    GAGTCCACAAGCAACGGTCTAATAACTTCAACAGTAACAGGGATTCTTGGGAGCCTTGGACTTCGAAAAC
    GCAGCAGAAGACAAGTTAACACCAGGGCCACGGGTAAATGCAATCCCAACTTACACTACTGGACTGCACA
    AGAACAACATAATGCTGCTGGGATTGCCTGGATCCCGTACTTTGGACCGGGTGCAGAAGGCATATACACT
    GAAGGCCTTATGCACAACCAAAATGCCTTAGTCTGTGGACTCAGACAACTTGCAAATGAAACAACTCAAG
    CTCTGCAGCTTTTCTTAAGGGCCACGACGGAGCTGCGGACATATACCATACTCAATAGGAAGGCCATAGA
    TTTCCTTCTGCGACGATGGGGCGGGACATGTAGGATCCTGGGACCAGATTGTTGCATTGAGCCACATGAT
    TGGACCAAAAACATCACTGATAAAATCAACCAAATCATCCATGATTTCATCGACAACCCTTTACCCAATC
    AGGATAATGATGATAATTGGTGGACGGGCTGGAGACAGTGGATCCCTGCAGGAATAGGCATTACTGGAAT
    TATTATTGCAATCATTGCTCTTCTTTGCGTCTGCAAGCTGCTTTGTTGAATATCAACTTGAATCATTAAT
    TTAAAGTTGATACATTTCTAACATTATAAATTATAATCTGATATTAATACTTGAAAATAAGGCTAATGCC
    AAATTCTGTGCCAAACTTGAAAGTAGGTTTACCAAAATCCTTTGAACTGGAATGCTTTAATGCTCTTTCT
    CAATACTATATAAGTTCCTTCCCAAAATAATATTGATGAAGATTAAGAAAAA
  • Protein Sequence : Show Sequence
    >AAB37096.1 virion spike glycoprotein precursor [Sudan ebolavirus]
    MEGLSLLQLPRDKFRKSSFFVWVIILFQKAFSMPLGVVTNSTLEVTEIDQLVCKDHLASTDQLKSVGLNL
    EGSGVSTDIPSATKRWGFRSGVPPQVVSYEAGEWAENCYNLEIKKPDGSECLPPPPDGVRGFPRCRYVHK
    AQGTGPCPGDYAFHKDGAFFLYDRLASTVIYRGVNFAEGVIAFLILAKPKETFLQSPPIREAANYTENTS
    SYYATSYLEYEIENFGAQHSTTLFKINNNTFVLLDRPHTPQFLFQLNDTIQLHQQLSNTTGKLIWTLDAN
    INADIGEWAFWENKKNLSEQLRGEELSFETLSLNETEDDDATSSRTTKGRISDRATRKYSDLVPKDSPGM
    VSLHVPEGETTLPSQNSTEGRRVDVNTQETITETTATIIGTNGNNMQISTIGTGLSSSQILSSSPTMAPS
    PETQTSTTYTPKLPVMTTEESTTPPRNSPGSTTEAPTLTTPENITTAVKTVWPQESTSNGLITSTVTGIL
    GSLGLRKRSRRQVNTRATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQ
    LANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDF
    IDNPLPNQDNDDNWWTGWRQWIPAGIGITGIIIAIIALLCVCKLLC
    
    
  • Molecule Role : Protective antigen
10. VP24
  • Gene Name : VP24
  • Sequence Strain (Species/Organism) : Ebola virus
  • NCBI Protein GI : SCD11538
  • Other Database IDs : CDD:283933
  • Taxonomy ID : 1570291
  • Protein Name : VP24
  • Protein pI : 9.73
  • Protein Weight : 27754.06
  • Protein Length : 287
  • Protein Note : monopartite
  • Protein Sequence : Show Sequence
    >SCD11538.1 VP24 [Ebola virus]
    MAKATGRYNLISPKKDLEKGVVLSDLCNFLVSQTIQGWKVYWAGIEFDVTHKGMALLHRLKTNDFAPAWS
    MTRNLFPHLFQNPNSTIESPLWALRVILAAGIQDQLIDQSLIEPLAGALGLISDWLLTTNTNHFNMRTQR
    VKEQLSLKMLSLIRSNILKFINKLDALHVVNYNGLLSSIEIGTQNHTIIITRTNMGFLVELQEPDKSAMN
    RKKPGPAKFSLLHESTLKAFTQGSSTRMQSLILEFNSSLAI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation :
11. VP24 from Reston ebolavirus
  • Gene Name : VP24 from Reston ebolavirus
  • Sequence Strain (Species/Organism) : Reston ebolavirus
  • VO ID : VO_0010860
  • NCBI Gene ID : 955193
  • NCBI Protein GI : 22789228
  • Locus Tag : REBOVgp7
  • Genbank Accession : AF522874
  • Protein Accession : NP_690586
  • Taxonomy ID : 186539
  • Gene Starting Position : 9831
  • Gene Ending Position : 11480
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 10.16
  • Protein Weight : 26779.18
  • Protein Length : 251
  • DNA Sequence : Show Sequence
    >NC_004161.1:9831-11480 Reston ebolavirus isolate Reston virus/M.fascicularis-tc/USA/1989/Philippines89-Pennsylvania, complete genome
    GGATGAAGATTAATTGCGGAGGAATCAGGAATTCAACTTTAGTTCCTTAAGGCCTCGTCCGAATCTTCAT
    CAGTTCGTAAGTTCTTTTATAGAAGTCATTAGCTTCTAAGGTGATTATATTTTAGTATTAAATTTTGCTA
    ATTGCTTGCTATAAAGTTGAAATGTCTAATGCTTAAATGAACACTTTTTTGAAGCTGACATACGAATACA
    TCATATCATATGAAAACATCGCAATTAGAGCGTCCTTGAAGTCTGGCATTGACAGTCACCAGGCTGTTCT
    CAGTAGTCTGTCCTTGGAAGCTCTTGGGGAGACAAAAAGAGGTCCCAGAGAGTCCCAACAGGTTGGCATA
    AGGTCATTAACACCAGCATAGTCGGCTCGACCAAGACTGTAAGCGAGTCGATTTCAACTAAAAAGATTAT
    TTCTTGTTGTTTAAACAAATTCCTTTTGTGTGAGACATCCTCAAGGCACAAGATGGCTAAAGCCACAGGC
    CGATACAATCTCGTGCCCCCAAAGAAAGATATGGAAAAGGGAGTGATTTTTAGTGATCTTTGTAATTTCT
    TGATTACTCAAACCCTGCAAGGTTGGAAGGTTTATTGGGCAGGAATTGAGTTTGATGTAAGTCAAAAAGG
    CATGGCTCTTCTGACAAGACTCAAAACAAATGACTTTGCTCCTGCCTGGGCGATGACAAGAAATCTTTTC
    CCACATCTGTTCCAGAACCCAAATTCGGTTATTCAATCTCCCATCTGGGCTTTGAGGGTAATTTTGGCAG
    CCGGATTGCAGGATCAGTTGTTAGACCATTCATTGGTTGAGCCATTGACAGGGGCTCTCGGTCTAATTTC
    TGATTGGCTCCTAACTACAACGTCAACACATTTCAATCTTCGTACTAGAAGCGTAAAGGACCAGCTTAGT
    CTTCGTATGTTATCTTTGATCAGGTCAAACATCTTGCAGTTCATCAACAAGCTTGACGCCCTGCATGTTG
    TCAATTACAATGGTTTACTCAGTAGTATTGAGATCGGGACTTCTACACACACAATCATTATAACTCGTAC
    AAATATGGGTTTTCTCGTGGAAGTTCAAGAGCCTGACAAATCAGCTATGAATTCTAAGCGCCCAGGACCA
    GTCAAGTTCTCATTACTTCATGAGTCTGCCTTCAAACCTTTCACTCGTGTTCCACAATCTGGGATGCAAT
    CATTAATAATGGAGTTCAACAGTTTGTTGGCAATTTAACAAGGTAATCTTAAAATAAGTACATGAATGAG
    AATTAGTTGTGGGTCTTATCTAGCATTGTTGAGTTAACTATCTAATCTATTTTCGCTAATTGCATTGAGC
    ACTGCTAATAGGTTTGTATCACGTTAAAGATTTAGAGTGTATGAATTGTGCAGATTTAAACTTGGGTTTT
    GCCTTATGCTTCATAGGTGGTCTTTTTGAAATGGAGATTATCAGCATTTCTTAAATGGGAGGAGTTAGCA
    ATCAGAAATTGGAGATAAATGGACATCGGGATAGAACAATGCCTAACTATTGGGCGGCTTCCATTTTTAC
    ATGTGTATATAACCAATCTTTTCCTATCTTTGCTTATATTGGTGTAACTTTATTTTAATAACATGTCAAT
    GCTATACTGTTAAGAGAAGGTCTGAGGAAGATTAAGAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_690586.1 membrane-associated protein [Reston ebolavirus]
    MAKATGRYNLVPPKKDMEKGVIFSDLCNFLITQTLQGWKVYWAGIEFDVSQKGMALLTRLKTNDFAPAWA
    MTRNLFPHLFQNPNSVIQSPIWALRVILAAGLQDQLLDHSLVEPLTGALGLISDWLLTTTSTHFNLRTRS
    VKDQLSLRMLSLIRSNILQFINKLDALHVVNYNGLLSSIEIGTSTHTIIITRTNMGFLVEVQEPDKSAMN
    SKRPGPVKFSLLHESAFKPFTRVPQSGMQSLIMEFNSLLAI
    
    
  • Molecule Role : Protective antigen
12. VP24 from Zaire ebolavirus
  • Gene Name : VP24 from Zaire ebolavirus
  • Sequence Strain (Species/Organism) : Zaire ebolavirus
  • VO ID : VO_0010866
  • NCBI Gene ID : 911828
  • NCBI Protein GI : 10313998
  • Locus Tag : ZEBOVgp6
  • Genbank Accession : AY142960
  • Protein Accession : NP_066250
  • Taxonomy ID : 186538
  • Gene Starting Position : 9884
  • Gene Ending Position : 11517
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 10.1
  • Protein Weight : 27225.61
  • Protein Length : 251
  • DNA Sequence : Show Sequence
    >NC_002549.1:9884-11517 Zaire ebolavirus isolate Ebola virus/H.sapiens-tc/COD/1976/Yambuku-Mayinga, complete genome
    TGATGAAGATTAATGCGGAGGTCTGATAAGAATAAACCTTATTATTCAGATTAGGCCCCAAGAGGCATTC
    TTCATCTCCTTTTAGCAAAGTACTATTTCAGGGTAGTCCAATTAGTGGCACGTCTTTTAGCTGTATATCA
    GTCGCCCCTGAGATACGCCACAAAAGTGTCTCTAAGCTAAATTGGTCTGTACACATCCCATACATTGTAT
    TAGGGGCAATAATATCTAATTGAACTTAGCCGTTTAAAATTTAGTGCATAAATCTGGGCTAACACCACCA
    GGTCAACTCCATTGGCTGAAAAGAAGCTTACCTACAACGAACATCACTTTGAGCGCCCTCACAATTAAAA
    AATAGGAACGTCGTTCCAACAATCGAGCGCAAGGTTTCAAGGTTGAACTGAGAGTGTCTAGACAACAAAA
    TATTGATACTCCAGACACCAAGCAAGACCTGAGAAAAAACCATGGCTAAAGCTACGGGACGATACAATCT
    AATATCGCCCAAAAAGGACCTGGAGAAAGGGGTTGTCTTAAGCGACCTCTGTAACTTCTTAGTTAGCCAA
    ACTATTCAGGGGTGGAAGGTTTATTGGGCTGGTATTGAGTTTGATGTGACTCACAAAGGAATGGCCCTAT
    TGCATAGACTGAAAACTAATGACTTTGCCCCTGCATGGTCAATGACAAGGAATCTCTTTCCTCATTTATT
    TCAAAATCCGAATTCCACAATTGAATCACCGCTGTGGGCATTGAGAGTCATCCTTGCAGCAGGGATACAG
    GACCAGCTGATTGACCAGTCTTTGATTGAACCCTTAGCAGGAGCCCTTGGTCTGATCTCTGATTGGCTGC
    TAACAACCAACACTAACCATTTCAACATGCGAACACAACGTGTCAAGGAACAATTGAGCCTAAAAATGCT
    GTCGTTGATTCGATCCAATATTCTCAAGTTTATTAACAAATTGGATGCTCTACATGTCGTGAACTACAAC
    GGATTGTTGAGCAGTATTGAAATTGGAACTCAAAATCATACAATCATCATAACTCGAACTAACATGGGTT
    TTCTGGTGGAGCTCCAAGAACCCGACAAATCGGCAATGAACCGCATGAAGCCTGGGCCGGCGAAATTTTC
    CCTCCTTCATGAGTCCACACTGAAAGCATTTACACAAGGATCCTCGACACGAATGCAAAGTTTGATTCTT
    GAATTTAATAGCTCTCTTGCTATCTAACTAAGGTAGAATACTTCATATTGAGCTAACTCATATATGCTGA
    CTCAATAGTTATCTTGACATCTCTGCTTTCATAATCAGATATATAAGCATAATAAATAAATACTCATATT
    TCTTGATAATTTGTTTAACCACAGATAAATCCTCACTGTAAGCCAGCTTCCAAGTTGACACCCTTACAAA
    AACCAGGACTCAGAATCCCTCAAACAAGAGATTCCAAGACAACATCATAGAATTGCTTTATTATATGAAT
    AAGCATTTTATCACCAGAAATCCTATATACTAAATGGTTAATTGTAACTGAACCCGCAGGTCACATGTGT
    TAGGTTTCACAGATTCTATATATTACTAACTCTATACTCGTAATTAACATTAGATAAGTAGATTAAGAAA
    AAAGCCTGAGGAAGATTAAGAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_066250.1 membrane-associated protein [Zaire ebolavirus]
    MAKATGRYNLISPKKDLEKGVVLSDLCNFLVSQTIQGWKVYWAGIEFDVTHKGMALLHRLKTNDFAPAWS
    MTRNLFPHLFQNPNSTIESPLWALRVILAAGIQDQLIDQSLIEPLAGALGLISDWLLTTNTNHFNMRTQR
    VKEQLSLKMLSLIRSNILKFINKLDALHVVNYNGLLSSIEIGTQNHTIIITRTNMGFLVELQEPDKSAMN
    RMKPGPAKFSLLHESTLKAFTQGSSTRMQSLILEFNSSLAI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : VP24 expressed from alphavirus replicons induced a protective immune response in BALB/c mice when challenged with Ebola virus Zaire (Wilson et al., 2001).
  • Additional Molecule Role : Protective antigen
  • Related Vaccine(s): VRP expressing VP24
13. VP30
  • Gene Name : VP30
  • Sequence Strain (Species/Organism) : Ebola virus
  • NCBI Protein GI : SCD11537
  • Other Database IDs : CDD:314419
  • Taxonomy ID : 1570291
  • Protein Name : VP30
  • Protein pI : 7.74
  • Protein Weight : 31662.28
  • Protein Length : 325
  • Protein Note : monopartite
  • Protein Sequence : Show Sequence
    >SCD11537.1 VP30 [Ebola virus]
    MEASYERGRPRAARQHSRDGHDHHVRARSSSRENYRGEYRQSRSASQVRVPTVFHKKRVEPLTVPPAPKD
    ICPTLKKGFLCDSSFCKKDHQLESLTDRELLLLIARKTCGSVEQQLNITAPKDSRLANPTADDFQQEEGP
    KITLLTLIKTAEHWARQDIRTIEDSKLRALLTLCAVMTRKFSKSQLSLLCETHLRREGLGQDQAEPVLEV
    YQRLHSDKGGSFEAALWQQWDRQSLIMFITAFLNIALQLPCESSAVVVSGLRTLVPQSDNEEASTNPGTC
    SWSDEGTP
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation :
14. VP30 from Reston ebolavirus
  • Gene Name : VP30 from Reston ebolavirus
  • Sequence Strain (Species/Organism) : Reston ebolavirus
  • VO ID : VO_0010862
  • NCBI Gene ID : 955196
  • NCBI Protein GI : 22789227
  • Locus Tag : REBOVgp6
  • Genbank Accession : AF522874
  • Protein Accession : NP_690585
  • Taxonomy ID : 186539
  • Gene Starting Position : 8261
  • Gene Ending Position : 9700
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 8.3
  • Protein Weight : 31307.9
  • Protein Length : 287
  • DNA Sequence : Show Sequence
    >NC_004161.1:8261-9700 Reston ebolavirus isolate Reston virus/M.fascicularis-tc/USA/1989/Philippines89-Pennsylvania, complete genome
    TGACGAAGATTAAAGGAGAGGATCGTTAACGGGAAAACCTCCCATCTCGTTCGTCGAAGCCACGTTGGTG
    GTGCTTGCAGCTGAGAACAACTCCAGAGATTGTAGGTAGAAAGGACCAACATTTATAGGTAGGGGTCAGA
    AAGCAACAATAACCATAAAAGGAGAGCCTGACATTGCTATTTAATATCCTAGAACCTGATTTCTAGGTTC
    TAGCTTTAAAATCCGGATGATGGAGCATTCAAGAGAACGGGGTAGATCTAGCAACATGCGACATAATAGC
    CGGGAACCATACGAAAATCCATCAAGGTCTCGCTCATTATCTCGGGACCCTAATCAGGTTGATCGTAGAC
    AGCCTCGAAGTGCATCCCAAATTCGTGTTCCGAATCTGTTCCATCGGAAAAAGACTGATGCACTCATAGT
    TCCTCCGGCTCCTAAAGATATATGCCCAACACTCAAAAAAGGATTCCTCTGCGATAGCAAATTTTGCAAA
    AAAGATCACCAATTGGATAGCTTAAATGATCATGAATTACTACTGCTAATTGCAAGAAGAACATGTGGAA
    TTATCGAGAGCAATTCGCAGATTACATCCCCAAAAGATATGCGGTTAGCGAATCCAACAGCTGAAGACTT
    CTCACAAGGTAATAGTCCTAAATTAACACTTGCAGTCCTTCTTCAAATTGCTGAACATTGGGCAACCAGA
    GACCTAAGGCAAATTGAGGACTCTAAACTTAGAGCTCTTTTAACCCTTTGTGCCGTATTAACAAGGAAAT
    TTTCTAAATCCCAACTGGGTCTTCTATGTGAGACCCACCTACGGCATGAGGGCCTCGGACAGGACCAAGC
    TGATTCTGTATTAGAGGTCTACCAAAGACTCCACAGTGATAAAGGAGGGAATTTTGAGGCTGCCCTGTGG
    CAACAATGGGACCGACAGTCATTAATAATGTTCATCTCTGCTTTTCTCAACATTGCTCTCCAGATACCTT
    GTGAAAGTTCTAGTGTCGTAGTCTCAGGTCTTGCCACATTGTACCCAGCACAAGACAATTCTACACCATC
    CGAGGCAACTAATGATACCACCTGGTCAAGTACAGTTGAATAGAAAACCACTGGAGCTATTTTTCCACGA
    TTGCTCTCAGTCAATAAATTAATATAGATATAATACGACTTCGGTGTGCAATTGTCAAGAGTTCCATTTA
    GTAATAATGATTCTTAAAACAATCTACTATCGCAATTATCGATGGATCTACCCTATTTGACGGTACATGA
    CTTGAATGTAATAAGGTAAGTTGGTATCTGAGGTATTTTGTCTAGAGTATACTCAAAATCGTATGTCTAG
    CAAATTATCAATAGCAAAGTTAAATTCTCCTAACCTCATATTTTGATCAAGTAATCATGATTTTATGATA
    ATTCTTTTCAGATTATCGGTTTAATCTTTATTAAGAAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_690585.1 minor nucleoprotein [Reston ebolavirus]
    MEHSRERGRSSNMRHNSREPYENPSRSRSLSRDPNQVDRRQPRSASQIRVPNLFHRKKTDALIVPPAPKD
    ICPTLKKGFLCDSKFCKKDHQLDSLNDHELLLLIARRTCGIIESNSQITSPKDMRLANPTAEDFSQGNSP
    KLTLAVLLQIAEHWATRDLRQIEDSKLRALLTLCAVLTRKFSKSQLGLLCETHLRHEGLGQDQADSVLEV
    YQRLHSDKGGNFEAALWQQWDRQSLIMFISAFLNIALQIPCESSSVVVSGLATLYPAQDNSTPSEATNDT
    TWSSTVE
    
    
  • Molecule Role : Protective antigen
15. VP30 from Zaire ebolavirus
  • Gene Name : VP30 from Zaire ebolavirus
  • Sequence Strain (Species/Organism) : Zaire ebolavirus
  • VO ID : VO_0010867
  • NCBI Gene ID : 911826
  • NCBI Protein GI : 10313997
  • Locus Tag : ZEBOVgp5
  • Genbank Accession : AF272001
  • Protein Accession : NP_066249
  • 3D structure: PDB ID : 2I8B
  • Taxonomy ID : 186538
  • Gene Starting Position : 8287
  • Gene Ending Position : 9739
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 8.23
  • Protein Weight : 31130.81
  • Protein Length : 288
  • DNA Sequence : Show Sequence
    >NC_002549.1:8287-9739 Zaire ebolavirus isolate Ebola virus/H.sapiens-tc/COD/1976/Yambuku-Mayinga, complete genome
    TGATGAAGATTAAGAAAAAGGTAATCTTTCGATTATCTTTAATCTTCATCCTTGATTCTACAATCATGAC
    AGTTGTCTTTAGTGACAAGGGAAAGAAGCCTTTTTATTAAGTTGTAATAATCAGATCTGCGAACCGGTAG
    AGTTTAGTTGCAACCTAACACACATAAAGCATTGGTCAAAAAGTCAATAGAAATTTAAACAGTGAGTGGA
    GACAACTTTTAAATGGAAGCTTCATATGAGAGAGGACGCCCACGAGCTGCCAGACAGCATTCAAGGGATG
    GACACGACCACCATGTTCGAGCACGATCATCATCCAGAGAGAATTATCGAGGTGAGTACCGTCAATCAAG
    GAGCGCCTCACAAGTGCGCGTTCCTACTGTATTTCATAAGAAGAGAGTTGAACCATTAACAGTTCCTCCA
    GCACCTAAAGACATATGTCCGACCTTGAAAAAAGGATTTTTGTGTGACAGTAGTTTTTGCAAAAAAGATC
    ACCAGTTGGAGAGTTTAACTGATAGGGAATTACTCCTACTAATCGCCCGTAAGACTTGTGGATCAGTAGA
    ACAACAATTAAATATAACTGCACCCAAGGACTCGCGCTTAGCAAATCCAACGGCTGATGATTTCCAGCAA
    GAGGAAGGTCCAAAAATTACCTTGTTGACACTGATCAAGACGGCAGAACACTGGGCGAGACAAGACATCA
    GAACCATAGAGGATTCAAAATTAAGAGCATTGTTGACTCTATGTGCTGTGATGACGAGGAAATTCTCAAA
    ATCCCAGCTGAGTCTTTTATGTGAGACACACCTAAGGCGCGAGGGGCTTGGGCAAGATCAGGCAGAACCC
    GTTCTCGAAGTATATCAACGATTACACAGTGATAAAGGAGGCAGTTTTGAAGCTGCACTATGGCAACAAT
    GGGACCGACAATCCCTAATTATGTTTATCACTGCATTCTTGAATATTGCTCTCCAGTTACCGTGTGAAAG
    TTCTGCTGTCGTTGTTTCAGGGTTAAGAACATTGGTTCCTCAATCAGATAATGAGGAAGCTTCAACCAAC
    CCGGGGACATGCTCATGGTCTGATGAGGGTACCCCTTAATAAGGCTGACTAAAACACTATATAACCTTCT
    ACTTGATCACAATACTCCGTATACCTATCATCATATATTTAATCAAGACGATATCCTTTAAAACTTATTC
    AGTACTATAATCACTCTCGTTTCAAATTAATAAGATGTGCATGATTGCCCTAATATATGAAGAGGTATGA
    TACAACCCTAACAGTGATCAAAGAAAATCATAATCTCGTATCGCTCGTAATATAACCTGCCAAGCATACC
    TCTTGCACAAAGTGATTCTTGTACACAAATAATGTTTTACTCTACAGGAGGTAGCAACGATCCATCCCAT
    CAAAAAATAAGTATTTCATGACTTACTAATGATCTCTTAAAATATTAAGAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_066249.1 minor nucleoprotein [Zaire ebolavirus]
    MEASYERGRPRAARQHSRDGHDHHVRARSSSRENYRGEYRQSRSASQVRVPTVFHKKRVEPLTVPPAPKD
    ICPTLKKGFLCDSSFCKKDHQLESLTDRELLLLIARKTCGSVEQQLNITAPKDSRLANPTADDFQQEEGP
    KITLLTLIKTAEHWARQDIRTIEDSKLRALLTLCAVMTRKFSKSQLSLLCETHLRREGLGQDQAEPVLEV
    YQRLHSDKGGSFEAALWQQWDRQSLIMFITAFLNIALQLPCESSAVVVSGLRTLVPQSDNEEASTNPGTC
    SWSDEGTP
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : VP30 expressed from alphavirus replicons induced a protective immune response in BALB/c mice when challenged with Ebola virus Zaire (Wilson et al., 2001).
  • Additional Molecule Role : Protective antigen
  • Related Vaccine(s): VRP expressing VP30
16. VP35
  • Gene Name : VP35
  • Sequence Strain (Species/Organism) : Ebola virus
  • NCBI Protein GI : SCD11532
  • Other Database IDs : CDD:280298
  • Taxonomy ID : 1570291
  • Protein Name : VP35
  • Protein pI : 5.92
  • Protein Weight : 36093.95
  • Protein Length : 377
  • Protein Note : monopartite
  • Protein Sequence : Show Sequence
    >SCD11532.1 VP35 [Ebola virus]
    MTTRTKGRGHTVATTQNDRMPGPELSGWISEQLMTGRIPVNDIFCDIENNPGLCYASQMQQTKPNPKMRN
    SQTQTDPICNHSFEEVVQTLASLATVVQQQTIASESLEQRITSLENGLKPVYDMAKTISSLNRVCAEMVA
    KYDLLVMTTGRATATAAATEAYWAEHGQPPPGPSLYEESAIRGKIESRDETVPQSVREAFNNLDSTTSLT
    EENFGKPDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQI
    TKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation :
17. VP35 from Reston ebolavirus
  • Gene Name : VP35 from Reston ebolavirus
  • Sequence Strain (Species/Organism) : Reston ebolavirus
  • VO ID : VO_0010863
  • NCBI Gene ID : 955189
  • NCBI Protein GI : 22789224
  • Locus Tag : REBOVgp2
  • Genbank Accession : AF522874
  • Protein Accession : NP_690581
  • Taxonomy ID : 186539
  • Gene Starting Position : 3018
  • Gene Ending Position : 4412
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 7.39
  • Protein Weight : 34622.88
  • Protein Length : 329
  • DNA Sequence : Show Sequence
    >NC_004161.1:3018-4412 Reston ebolavirus isolate Reston virus/M.fascicularis-tc/USA/1989/Philippines89-Pennsylvania, complete genome
    TGATGAAGATTAAAACCTTCATCGCCAGTAAATGATTATATTGTCTGTAGGCAGGTGTTTACTCCACCTT
    AAATTTGGAAATATCCTACCTTAGGACCATTGTCAAGAGGTGCATAGGCATTACCACCCTTGAGAACATG
    TACAATAATAAATTGAAGGTATGTTCAGGCCCAGAAACGACTGGATGGATTTCTGAGCAACTTATGACAG
    GTAAGATTCCAGTAACTGATATATTCATTGATATTGATAACAAGCCAGATCAAATGGAAGTCCGACTCAA
    ACCATCATCAAGGAGCTCAACAAGAACTTGTACAAGTAGCAGTCAGACGGAGGTCAACTATGTACCTCTC
    CTTAAAAAGGTTGAGGATACATTAACTATGCTAGTGAATGCCACCAGTCGTCAGAATGCTGCAATCGAGG
    CCCTTGAAAACCGCCTCAGCACACTTGAGAGTAGCTTAAAGCCAATCCAAGACATGGGTAAAGTGATTTC
    ATCATTGAATCGCAGTTGTGCCGAAATGGTTGCAAAATATGATCTTCTAGTTATGACAACTGGACGGGCT
    ACTTCAACTGCAGCTGCAGTAGATGCGTATTGGAAAGAGCACAAACAGCCACCACCAGGGCCAGCGTTGT
    ATGAAGAGAATGCGCTTAAAGGAAAAATCGATGATCCAAACAGCTATGTACCAGATGCTGTGCAAGAGGC
    TTACAAGAACCTTGACAGTACATCGACCCTGACCGAGGAAAATTTTGGGAAACCTTATATATCTGCTAAA
    GACCTGAAGGAGATCATGTATGATCATCTACCTGGTTTTGGGACTGCCTTTCACCAACTTGTTCAAGTGA
    TTTGTAAAATAGGAAAGGATAACAACCTTTTGGACACAATCCATGCTGAGTTCCAGGCAAGTCTAGCAGA
    TGGTGACTCTCCCCAATGTGCACTCATACAGATAACCAAAAGGGTCCCAATCTTTCAGGATGTGCCGCCC
    CCGATAATCCATATTAGATCCCGTGGTGACATCCCACGAGCATGCCAAAAGAGTCTCCGACCAGCACCAC
    CATCACCCAAAATTGATCGTGGTTGGGTTTGTTTGTTTAAGATGCAAGATGGTAAAACGCTTGGACTTAA
    GATCTAAGAATCAAGATTTATTTAACAAGGCAAGCCACAACCTTAGATGGAACCTCAGCCAGACTATTGA
    ACTATTGACGCTGTTGATGATAATATATAATTAATGGTCTTATTTGAATATGACAACATCTTGCTTCTTG
    TTCTGCCTTGTAGCTCTTTGAATTGGAAGATCATTCCAAACTTACAAACATGCACAAGATGTTATGGTTT
    AGCAAAGAATTGATAGGAGTACTGGTATATAATGTAAATATAACAAGTGATGAAGATTAAGAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_690581.1 polymerase complex protein [Reston ebolavirus]
    MYNNKLKVCSGPETTGWISEQLMTGKIPVTDIFIDIDNKPDQMEVRLKPSSRSSTRTCTSSSQTEVNYVP
    LLKKVEDTLTMLVNATSRQNAAIEALENRLSTLESSLKPIQDMGKVISSLNRSCAEMVAKYDLLVMTTGR
    ATSTAAAVDAYWKEHKQPPPGPALYEENALKGKIDDPNSYVPDAVQEAYKNLDSTSTLTEENFGKPYISA
    KDLKEIMYDHLPGFGTAFHQLVQVICKIGKDNNLLDTIHAEFQASLADGDSPQCALIQITKRVPIFQDVP
    PPIIHIRSRGDIPRACQKSLRPAPPSPKIDRGWVCLFKMQDGKTLGLKI
    
    
  • Molecule Role : Protective antigen
18. VP35 from Zaire ebolavirus
  • Gene Name : VP35 from Zaire ebolavirus
  • Sequence Strain (Species/Organism) : Zaire ebolavirus
  • VO ID : VO_0010864
  • NCBI Gene ID : 911827
  • NCBI Protein GI : 10313992
  • Locus Tag : ZEBOVgp2
  • Genbank Accession : AF272001
  • Protein Accession : NP_066244
  • 3D structure: PDB ID : 3FKE
  • Taxonomy ID : 186538
  • Gene Starting Position : 3031
  • Gene Ending Position : 4406
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 6.62
  • Protein Weight : 35575.45
  • Protein Length : 340
  • DNA Sequence : Show Sequence
    >NC_002549.1:3031-4406 Zaire ebolavirus isolate Ebola virus/H.sapiens-tc/COD/1976/Yambuku-Mayinga, complete genome
    TGATGAAGATTAAAACCTTCATCATCCTTACGTCAATTGAATTCTCTAGCACTCGAAGCTTATTGTCTTC
    AATGTAAAAGAAAAGCTGGTCTAACAAGATGACAACTAGAACAAAGGGCAGGGGCCATACTGCGGCCACG
    ACTCAAAACGACAGAATGCCAGGCCCTGAGCTTTCGGGCTGGATCTCTGAGCAGCTAATGACCGGAAGAA
    TTCCTGTAAGCGACATCTTCTGTGATATTGAGAACAATCCAGGATTATGCTACGCATCCCAAATGCAACA
    AACGAAGCCAAACCCGAAGACGCGCAACAGTCAAACCCAAACGGACCCAATTTGCAATCATAGTTTTGAG
    GAGGTAGTACAAACATTGGCTTCATTGGCTACTGTTGTGCAACAACAAACCATCGCATCAGAATCATTAG
    AACAACGCATTACGAGTCTTGAGAATGGTCTAAAGCCAGTTTATGATATGGCAAAAACAATCTCCTCATT
    GAACAGGGTTTGTGCTGAGATGGTTGCAAAATATGATCTTCTGGTGATGACAACCGGTCGGGCAACAGCA
    ACCGCTGCGGCAACTGAGGCTTATTGGGCCGAACATGGTCAACCACCACCTGGACCATCACTTTATGAAG
    AAAGTGCGATTCGGGGTAAGATTGAATCTAGAGATGAGACCGTCCCTCAAAGTGTTAGGGAGGCATTCAA
    CAATCTAAACAGTACCACTTCACTAACTGAGGAAAATTTTGGGAAACCTGACATTTCGGCAAAGGATTTG
    AGAAACATTATGTATGATCACTTGCCTGGTTTTGGAACTGCTTTCCACCAATTAGTACAAGTGATTTGTA
    AATTGGGAAAAGATAGCAACTCATTGGACATCATTCATGCTGAGTTCCAGGCCAGCCTGGCTGAAGGAGA
    CTCTCCTCAATGTGCCCTAATTCAAATTACAAAAAGAGTTCCAATCTTCCAAGATGCTGCTCCACCTGTC
    ATCCACATCCGCTCTCGAGGTGACATTCCCCGAGCTTGCCAGAAAAGCTTGCGTCCAGTCCCACCATCGC
    CCAAGATTGATCGAGGTTGGGTATGTGTTTTTCAGCTTCAAGATGGTAAAACACTTGGACTCAAAATTTG
    AGCCAATCTCCCTTCCCTCCGAAAGAGGCGAATAATAGCAGAGGCTTCAACTGCTGAACTATAGGGTACG
    TTACATTAATGATACACTTGTGAGTATCAGCCCTGGATAATATAAGTCAATTAAACGACCAAGATAAAAT
    TGTTCATATCTCGCTAGCAGCTTAAAATATAAATGTAATAGGAGCTATATCTCTGACAGTATTATAATCA
    ATTGTTATTAAGTAACCCAAACCAAAAGTGATGAAGATTAAGAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_066244.1 polymerase complex protein [Zaire ebolavirus]
    MTTRTKGRGHTAATTQNDRMPGPELSGWISEQLMTGRIPVSDIFCDIENNPGLCYASQMQQTKPNPKTRN
    SQTQTDPICNHSFEEVVQTLASLATVVQQQTIASESLEQRITSLENGLKPVYDMAKTISSLNRVCAEMVA
    KYDLLVMTTGRATATAAATEAYWAEHGQPPPGPSLYEESAIRGKIESRDETVPQSVREAFNNLNSTTSLT
    EENFGKPDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQI
    TKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : VP35 expressed from alphavirus replicons induced a protective immune response in C57BL/6 mice when challenged with Ebola virus Zaire (Wilson et al., 2001).
  • Additional Molecule Role : Protective antigen
  • Related Vaccine(s): VRP expressing VP35
19. VP40 from Reston ebolavirus
  • Gene Name : VP40 from Reston ebolavirus
  • Sequence Strain (Species/Organism) : Reston ebolavirus
  • VO ID : VO_0010861
  • NCBI Gene ID : 955192
  • NCBI Protein GI : 22789225
  • Locus Tag : REBOVgp3
  • Genbank Accession : AF522874
  • Protein Accession : NP_690582
  • 3D structure: PDB ID : 1ES6
  • Taxonomy ID : 186539
  • Gene Starting Position : 4395
  • Gene Ending Position : 5892
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 8.98
  • Protein Weight : 33340.06
  • Protein Length : 331
  • DNA Sequence : Show Sequence
    >NC_004161.1:4395-5892 Reston ebolavirus isolate Reston virus/M.fascicularis-tc/USA/1989/Philippines89-Pennsylvania, complete genome
    TGATGAAGATTAAGAAAAACCAGTCGGTATTTTCCAGACTTGGCATTTCTTATCTTCATCTTCTAAAGTG
    AGATATTTTATCATCAAAAAATGAGGCGCGGAGTGTTACCAACGGCTCCTCCAGCATATAATGATATTGC
    ATACCCTATGAGCATACTCCCAACCCGACCAAGTGTCATAGTCAATGAGACCAAATCAGATGTACTGGCA
    GTGCCAGGGGCAGATGTTCCATCAAACTCCATGAGACCAGTGGCTGATGATAACATTGATCACTCAAGCC
    ATACTCCAAGCGGAGTAGCTTCTGCCTTTATATTGGAAGCTACAGTGAATGTAATTTCGGGAACAAAAGT
    CCTGATGAAGCAAATACCTATTTGGCTTCCACTGGGTGTAGCTGATCAGAAGATATACAGCTTTGATTCA
    ACAACAGCCGCAATTATGTTGGCTTCCTACACAGTGACACACTTCGGGAAGATATCTAACCCGCTGGTAC
    GTGTCAACAGGCTAGGCCCAGGAATACCCGATCATCCGCTACGACTCCTAAGGTTGGGCAATCAGGCATT
    CCTTCAAGAGTTTGTTCTTCCACCAGTCCAGCTTCCCCAGTATTTCACATTTGATCTAACAGCTCTAAAG
    CTCATCACTCAACCATTGCCAGCTGCAACCTGGACAGACGAAACTCCAGCAGGAGCAGTCAATGCTCTTC
    GTCCTGGGCTCTCACTCCATCCCAAGCTTCGTCCAATTCTCCTGCCGGGGAAGACAGGAAAGAAAGGACA
    TGCTTCAGACTTAACATCACCTGACAAGATTCAAACAATCATGAATGCAATACCGGACCTCAAAATTGTC
    CCGATTGATCCAACCAAGAACATAGTTGGAATTGAGGTTCCAGAATTACTAGTTCAAAGGCTGACCGGCA
    AAAAACCACAACCCAAAAATGGCCAACCAATTATTCCAGTTCTTCTTCCGAAATATGTTGGACTTGATCC
    TATATCGCCAGGGGACTTAACTATGGTTATCACCCAGGATTGTGATTCATGCCACTCTCCAGCCAGCCAT
    CCGTATCACATGGACAAGCAGAATAGTTACCAATAATTTAAATTCCATTCGAGCTATTATTCTGCTAGTA
    ATTCCGACGGGATCAATAGACTAAAAATCTGATTGTATAGAATTATAAAAGAATCAAGCAGAGGCAACAG
    ACTCACAGCTTACGCCTAGATAACTAATATTAAGGAGTTTTTTAATCTAATTTTCCAGTCTTGAGTAATA
    ATCATTTCTTTTGTAATTAATTATGCATTTGTTAACTTATCGGTGCGAGATTTCCTTGAGAACCCGGCGG
    AGCTTCTACTATCTGCAGTAACCAGAAGAGAAGTTCAACCCAGTCAAAACTAAACCAAGCAATATTCTGA
    ATGCTCTATAGTCTATTCTAATCAGAGGTATAACAATGGCTAAGATTTCAATGACTCGTTAACAATCGCT
    AGTAATTTTAATCTCCAGATTAAGAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_690582.1 matrix protein [Reston ebolavirus]
    MRRGVLPTAPPAYNDIAYPMSILPTRPSVIVNETKSDVLAVPGADVPSNSMRPVADDNIDHSSHTPSGVA
    SAFILEATVNVISGTKVLMKQIPIWLPLGVADQKIYSFDSTTAAIMLASYTVTHFGKISNPLVRVNRLGP
    GIPDHPLRLLRLGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDETPAGAVNALRPGLSLH
    PKLRPILLPGKTGKKGHASDLTSPDKIQTIMNAIPDLKIVPIDPTKNIVGIEVPELLVQRLTGKKPQPKN
    GQPIIPVLLPKYVGLDPISPGDLTMVITQDCDSCHSPASHPYHMDKQNSYQ
    
    
  • Molecule Role : Protective antigen
20. VP40 from Zaire ebolavirus
  • Gene Name : VP40 from Zaire ebolavirus
  • Sequence Strain (Species/Organism) : Zaire ebolavirus
  • VO ID : VO_0010868
  • NCBI Gene ID : 911825
  • NCBI Protein GI : 10313993
  • Locus Tag : ZEBOVgp3
  • Genbank Accession : AF272001
  • Protein Accession : NP_066245
  • 3D structure: PDB ID : 1ES6
  • Taxonomy ID : 186538
  • Gene Starting Position : 4389
  • Gene Ending Position : 5893
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 9.02
  • Protein Weight : 33197.88
  • Protein Length : 326
  • DNA Sequence : Show Sequence
    >NC_002549.1:4389-5893 Zaire ebolavirus isolate Ebola virus/H.sapiens-tc/COD/1976/Yambuku-Mayinga, complete genome
    TGATGAAGATTAAGAAAAACCTACCTCGGCTGAGAGAGTGTTTTTTCATTAACCTTCATCTTGTAAACGT
    TGAGCAAAATTGTTAAAAATATGAGGCGGGTTATATTGCCTACTGCTCCTCCTGAATATATGGAGGCCAT
    ATACCCTGTCAGGTCAAATTCAACAATTGCTAGAGGTGGCAACAGCAATACAGGCTTCCTGACACCGGAG
    TCAGTCAATGGGGACACTCCATCGAATCCACTCAGGCCAATTGCCGATGACACCATCGACCATGCCAGCC
    ACACACCAGGCAGTGTGTCATCAGCATTCATCCTTGAAGCTATGGTGAATGTCATATCGGGCCCCAAAGT
    GCTAATGAAGCAAATTCCAATTTGGCTTCCTCTAGGTGTCGCTGATCAAAAGACCTACAGCTTTGACTCA
    ACTACGGCCGCCATCATGCTTGCTTCATACACTATCACCCATTTCGGCAAGGCAACCAATCCACTTGTCA
    GAGTCAATCGGCTGGGTCCTGGAATCCCGGATCATCCCCTCAGGCTCCTGCGAATTGGAAACCAGGCTTT
    CCTCCAGGAGTTCGTTCTTCCGCCAGTCCAACTACCCCAGTATTTCACCTTTGATTTGACAGCACTCAAA
    CTGATCACCCAACCACTGCCTGCTGCAACATGGACCGATGACACTCCAACAGGATCAAATGGAGCGTTGC
    GTCCAGGAATTTCATTTCATCCAAAACTTCGCCCCATTCTTTTACCCAACAAAAGTGGGAAGAAGGGGAA
    CAGTGCCGATCTAACATCTCCGGAGAAAATCCAAGCAATAATGACTTCACTCCAGGACTTTAAGATCGTT
    CCAATTGATCCAACCAAAAATATCATGGGAATCGAAGTGCCAGAAACTCTGGTCCACAAGCTGACCGGTA
    AGAAGGTGACTTCTAAAAATGGACAACCAATCATCCCTGTTCTTTTGCCAAAGTACATTGGGTTGGACCC
    GGTGGCTCCAGGAGACCTCACCATGGTAATCACACAGGATTGTGACACGTGTCATTCTCCTGCAAGTCTT
    CCAGCTGTGATTGAGAAGTAATTGCAATAATTGACTCAGATCCAGTTTTATAGAATCTTCTCAGGGATAG
    TGATAACATCTATTTAGTAATCCGTCCATTAGAGGAGACACTTTTAATTGATCAATATACTAAAGGTGCT
    TTACACCATTGTCTTTTTTCTCTCCTAAATGTAGAACTTAACAAAAGACTCATAATATACTTGTTTTTAA
    AGGATTGATTGATGAAAGATCATAACTAATAACATTACAAATAATCCTACTATAATCAATACGGTGATTC
    AAATGTTAATCTTTCTCATTGCACATACTTTTTGCCCTTATCCTCAAATTGCCTGCATGCTTACATCTGA
    GGATAGCCAGTGTGACTTGGATTGGAAATGTGGAGAAAAAATCGGGACCCATTTCTAGGTTGTTCACAAT
    CCAAGTACAGACATTGCCCTTCTAATTAAGAAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_066245.1 matrix protein [Zaire ebolavirus]
    MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVS
    SAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGP
    GIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFH
    PKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKN
    GQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Vaccination of BALB/c or C57BL/6 mice with eVLPs, composed of the EBOV glycoprotein and matrix viral protein (VP)40 with a lipid membrane, in conjunction with QS-21 adjuvant resulted in mixed IgG subclass responses, a Th1-like memory cytokine response, and protection from lethal EBOV challenge (Warfield et al., 2005).

    VP40 expressed from alphavirus replicons induced a protective immune response in BALB/c mice when challenged with Ebola virus Zaire (Wilson et al., 2001).
  • Related Vaccine(s): rVSV- SEBOV-GP and -VP40 , VRP expressing VP40
21. ZGP
  • Gene Name : ZGP
  • Sequence Strain (Species/Organism) : Zaire ebolavirus strain Zaire95
  • NCBI Nucleotide GI : 1695251
  • NCBI Protein GI : 1695253
  • Protein Accession : AAB37095.1
  • Other Database IDs : CDD:279888
    CDD:333284
    CDD:197367
  • Taxonomy ID : 186538
  • Gene Strand (Orientation) : ?
  • Protein Name : virion spike glycoprotein
  • Protein pI : 6.69
  • Protein Weight : 71315.12
  • Protein Length : 744
  • Protein Note : Filovirus glycoprotein; pfam01611
  • DNA Sequence : Show Sequence
    >gi|1695251|gb|U28077.1|EVU28077 Zaire Ebola virus strain Zaire95 virion spike glycoprotein (SP) gene, complete cds, and small/secreted glycoprotein precursor (SGP) gene, complete cds
    GCGATGAAGATTAAGCCGACAGTGAGCGTAATCTTCATCTCTCTTAGATTATTTGTCCTCCAGAGTAGGG
    ATCGTCAGGTCCTTTTCAATCGTATAACCAAAATAAACTTCACTAGAAGGATATTGTGGGGCAACAACAC
    AATGGGTGTTACAGGAATATTGCAGTTACCTCGTGATCGATTCAAGAGGACATCATTCTTTCTTTGGGTA
    ATTATCCTTTTCCAAAGAACATTTTCCATCCCACTTGGAGTCATCCACAATAGCACATTACAGGTTAGTG
    ATGTCGACAAACTGGTTTGCCGTGACAAACTGTCATCCACAAATCAATTGAGATCAGTTGGACTGAATCT
    CGAAGGGAATGGAGTGGCAACTGACGTGCCATCTGCAACTAAAAGATGGGGCTTCAGGTCCGGTGTCCCA
    CCAAAGGTGGTCAATTATGAAGCTGGTGAATGGGCTGAAAACTGCTACAATCTTGAAATCAAAAAACCTG
    ACGGGAGTGAGTGTCTACCAGCAGCGCCAGACGGGATTCGGGGCTTCCCCCGGTGCCGGTATGTGCACAA
    AGTATCAGGAACGGGACCGTGTGCCGGAGACTTTGCCTTCCACAAAGAGGGTGCTTTCTTCCTGTATGAC
    CGACTTGCTTCCACAGTTATCTACCGAGGAACGACTTTCGCTGAAGGTGTCGTTGCATTTCTGATACTGC
    CCCAAGCTAAGAAGGACTTCTTCAGCTCACACCCCTTGAGAGAGCCGGTCAATGCAACGGAGGACCCGTC
    TAGTGGCTACTATTCTACCACAATTAGATATCAAGCTACCGGTTTTGGAACCAATGAGACAGAGTATTTG
    TTCGAGGTTGACAATTTGACCTACGTCCAACTTGAATCAAGATTCACACCACAGTTTCTGCTCCAGCTGA
    ATGAGACAATATATACAAGTGGGAAAAGGAGCAATACCACGGGAAAACTAATTTGGAAGGTCAACCCCGA
    AATTGATACAACAATCGGGGAGTGGGCCTTCTGGGAAACTAAAAAAACCTCACTAGAAAAATTCGCAGTG
    AAGAGTTGTCTTTCACAGCTGTATCAAACAGAGCCAAAAACATCAGTGGTCAGAGTCCGGCGCGAACTTC
    TTCCGACCCAGGGACCAACACAACAACTGAAGACCACAAAATCATGGCTTCAGAAAATTCCTCTGCAATG
    GTTCAAGTGCACAGTCAAGGAAGGGAAGCTGCAGTGTCGCATCTGACAACCCTTGCCACAATCTCCACGA
    GTCCTCAACCCCCCACAACCAAACCAGGTCCGGACAACAGCACCCACAATACACCCGTGTATAAACTTGA
    CATCTCTGAGGCAACTCAAGTTGAACAACATCACCGCAGAACAGACAACGACAGCACAGCCTCCGACACT
    CCCCCCGCCACGACCGCAGCCGGACCCCTAAAAGCAGAGAACACCAACACGAGCAAGGGTACCGACCTCC
    TGGACCCCGCCACCACAACAAGTCCCCAAAACCACAGCGAGACCGCTGGCAACAACAACACTCATCACCA
    AGATACCGGAGAAGAGAGTGCCAGCAGCGGGAAGCTAGGCTTAATTACCAATACTATTGCTGGAGTCGCA
    GGACTGATCACAGGCGGGAGGAGAGCTCGAAGAGAAGCAATTGTCAATGCTCAACCCAAATGCAACCCTA
    ATTTACATTACTGGACTACTCAGGATGAAGGTGCTGCAATCGGACTGGCCTGGATACCATATTTCGGGCC
    AGCAGCCGAGGGAATTTACACAGAGGGGCTGATGCACAATCAAGATGGTTTAATCTGTGGGTTGAGACAG
    CTGGCCAACGAGACGACTCAAGCTCTTCAACTGTTCCTGAGAGCCACAACCGAGCTACGCACCTTTTCAA
    TCCTCAACCGTAAGGCAATTGATTTCTTGCTGCAGCGATGGGGCGGCACATGCCACATTTTGGGACCGGA
    CTGCTGTATCGAACCACATGATTGGACCAAGAACATAACAGACAAAATTGATCAGATTATTCATGATTTT
    GTTGATAAAACCCTTCCGGACCAGGGGGACAATGACAATTGGTGGACAGGATGGAGACAATGGATACCGG
    CAGGTATTGGAGTTACAGGCGTTATAATTGCAGTTATCGCTTTATTCTGTATATGCAAATTTGTCTTTTA
    GTTTTTCTTCAGATTGCTTCATGGCAAAGCTCAGCCTCAAATCAATGAAACCAGGATTTAATTATATGGA
    TTACTTGAATCTAAGATTACTTGACAAATGATAATATAATACACTGGAGCTTTAAACATAGCCAATGTGA
    TTCTAACTCTTTTAAACTCACAGTTAATCATAAATAAGGTTTGACATCAATCTAGTTATCTCTTTGAGAA
    TGATAAACTTGATGAAGATTAAGAAAAA
  • Protein Sequence : Show Sequence
    >AAB37095.1 virion spike glycoprotein [Zaire ebolavirus]
    MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSVGLNL
    EGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHK
    VSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPS
    SGYYSTTIRYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYTSGKRSNTTGKLIWKVNPE
    IDTTIGEWAFWETKKNLTRKIRSEELSFTAVSNRAKNISGQSPARTSSDPGTNTTTEDHKIMASENSSAM
    VQVHSQGREAAVSHLTTLATISTSPQPPTTKPGPDNSTHNTPVYKLDISEATQVEQHHRRTDNDSTASDT
    PPATTAAGPLKAENTNTSKGTDLLDPATTTSPQNHSETAGNNNTHHQDTGEESASSGKLGLITNTIAGVA
    GLITGGRRARREAIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYTEGLMHNQDGLICGLRQ
    LANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKIDQIIHDF
    VDKTLPDQGDNDNWWTGWRQWIPAGIGVTGVIIAVIALFCICKFVF
    
    
  • Molecule Role : Protective antigen
III. Vaccine Information
1. cAdVax-based bivalent ebola virus vaccine (Sudan and Zaire species)
a. Vaccine Ontology ID:
VO_0004647
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Human
e. Gene Engineering of GP from Sudan ebolavirus
  • Type: Recombinant protein preparation
  • Description: The gene was inserted into a single complex adenovirus-based vaccine (cAdVax) vector (Wang et al., 2006).
  • Detailed Gene Information: Click here.
f. Gene Engineering of GP from Zaire ebolavirus
  • Type: Recombinant protein preparation
  • Description: The gene was inserted into a single complex adenovirus-based vaccine (cAdVax) vector (Wang et al., 2006).
  • Detailed Gene Information: Click here.
g. Preparation
The bivalent cAdVaxE(GPs/z) vaccine includes the SEBOV glycoprotein (GP) and ZEBOV GP genes together in a single complex adenovirus-based vaccine (cAdVax) vector (Wang et al., 2006).
h. Immunization Route
Intramuscular injection (i.m.)
i. Mouse Response
  • Vaccine Immune Response Type: VO_0003057
  • Immune Response: Vaccination of mice with the bivalent cAdVaxE(GPs/z) vaccine led to efficient induction of EBOV-specific antibody and cell-mediated immune responses to both species of EBOV (Wang et al., 2006).
  • Challenge Protocol: Mice were challenged with a lethal dose of ZEBOV (30,000 times the 50% lethal dose) (Wang et al., 2006).
  • Efficacy: the cAdVax technology demonstrated induction of a 100% protective immune response in mice, as all vaccinated C57BL/6 and BALB/c mice survived challenge with a lethal dose of ZEBOV (Wang et al., 2006).
2. CAdVax-Filoviruses (Ebola )
a. Vaccine Ontology ID:
VO_0004644
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Preparation
A panfilovirus vaccine based on a complex adenovirus (CAdVax) technology that expresses multiple antigens from five different filoviruses de novo (Swenson et al., 2008).
f. Immunization Route
Intramuscular injection (i.m.)
g. Macaque Response
  • Vaccination Protocol: The macaques in the vaccine groups (five per group) were anesthetized by intramuscular injection of ketamine HCl (10 mg/kg of body weight), followed by intramuscular vaccination with an equal mixture of 1 × 1010 PFU of each vaccine component: EBO2, EBO7, M8, and M11 (resulting in 4 × 1010 total PFU per animal). Control animals received 4 × 1010 PFU of the HC4 vaccine vector, also via the intramuscular route (Swenson et al., 2008).
  • Vaccine Immune Response Type: VO_0000287
  • Challenge Protocol: Group 1 was inoculated subcutaneously with MARV Musoke, while group 2 was inoculated intramuscularly with ZEBOV, using approximately 1,000 PFU of each filovirus. EBOV and MARV each have different established routes of administration (intramuscular and subcutaneous, respectively) (Swenson et al., 2008).
  • Efficacy: All vaccinated animals showed no detectable viremia or hematology abnormalities. We can conclude that the multivalent filovirus vaccine was 100% protective against lethal MARV Musoke and ZEBOV challenges (Swenson et al., 2008).
3. CAdVax-ZEBOV/SEBOV
a. Vaccine Ontology ID:
VO_0004641
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Preparation
A multivalent vaccine candidate (EBO7) that expresses the glycoproteins of Zaire ebolavirus (ZEBOV) and Sudan ebolavirus (SEBOV) in a single complex adenovirus-based vector (CAdVax) (Pratt et al., 2010).
f. Immunization Route
Intramuscular injection (i.m.)
g. Macaque Response
  • Vaccination Protocol: For the parenteral challenge studies, cynomolgus macaques were vaccinated intramuscularly (i.m.) on day zero with a 1:1 mixture of 1 × 1010 PFU each of EBO7 and M8 (total 2 × 1010 PFU). Control animals received an i.m. injection of 2 × 1010 PFU of HC4. For the initial aerosol infection experiments, cynomolgus macaques were vaccinated by i.m. injection of 1 × 1010 PFU of EBO7 or 1 × 1010 PFU of HC4 (Pratt et al., 2010).
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: For the aerosol infection group, twenty-eight days after vaccination, animals were anesthetized and exposed to a target dose of 1,000 PFU of either aerosolized ZEBOV or aerosolized SEBOV. For the parenteral challenge studies, six weeks after the boosting vaccinations, the macaques were anesthetized by i.m. injection of Telazol (2 to 6 mg/kg of body weight) and then inoculated i.m. with SEBOV or ZEBOV challenge stock (Pratt et al., 2010).
  • Efficacy: EBO7 vaccine provided protection against both Ebola viruses by either route of infection. Significantly, protection against SEBOV given as an aerosol challenge, which has not previously been shown, could be achieved with a boosting vaccination (Pratt et al., 2010).
4. DNA vaccine expressing sGP
a. Vaccine Ontology ID:
VO_0000785
b. Type:
DNA vaccine
c. Gene Engineering of GP from Reston ebolavirus
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
d. Vector:
pCMV (Xu et al., 1998)
e. Preparation
Plasmids containing the sGP cDNAs are used to subclone the relevant inserts into CMV expression vectors, which utilize the bovine growth hormone polyadenylation sequence. The plasmid pCRII-sGP is digested with EcoRI and treated with Klenow enzyme, and the resulting fragment is inserted into the BamHI/Bg/II CMV plasmid, which has been incubated with Klenow fragment and calf intestinal phosphate (CIP), and phenol chloroform extracted (Xu et al., 1998).
f. Description
sGP is a secreted or transmembrane form of glycoprotein (Xu et al., 1998).
g. Guinea pig Response
  • Vaccination Protocol: Two groups of guinea pigs were immunized by injection of 0.5 mg/ml in each hind leg (two injections at each time point) with the plasmed expression vectors. Animals were challenged by inoculation with a stock of Ebola virus that had been passaged once in Vero E6 cells and serially passaged by intraperitoneal injection of slpeen homogenates in Hartley guinea pigs seven times. Immunized guinea pigs were injected intraperitoneally with 0.5 ml of a 1:1000 dillution of spleen cell homogenate in Hanks' balanced salt solution 122 days after the initial plasmid DNA injection. Survival was determined 10 days later at which times animals were killed for serologic and pathologic analysis (Xu et al., 1998).
  • Persistence: None noted
  • Immune Response: A broad immune response was conferred by sGP which induced both cellular and humoral immunity to the membrane-associated GP. The ability of vectors expressing GP to confer immunity may be explained by the generation of the lower molecular weight degradation products, which could provide sufficient protein for antigen presentation to induce detectable, cellular and humoral immune responses in guinea pigs (Xu et al., 1998).
  • Side Effects: None noted
  • Efficacy: For the first group of 6 giunea pigs, animals were challenged within 2 months after the initial immunization. Five of six of the immunized subjects survived in contrast to 0/6 control subjects. In the second group, guinea pigs were challenged 4 months after the initial immunization. Three of the five guinea pigs immunized with sGP showed no ill effects following the viral challenge (Xu et al., 1998).
5. Ebola virus DNA vaccine DNA/rAd5 encoding ZEBOV and SEBOV antigens
a. Vaccine Ontology ID:
VO_0004385
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Macaque
e. Gene Engineering of GP from Sudan ebolavirus
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
f. Gene Engineering of GP from Zaire ebolavirus
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
g. Vector:
Replication-defective rAd5 GP vectors and p1012 (Hensley et al., 2010)
h. Immunization Route
Intramuscular injection (i.m.)
i. Macaque Response
  • Vaccination Protocol: Four cynomolgus macaques were injected at 4–6 week intervals with GP(Z) and GP(S/G) DNA, followed by a rest period, and boosted after one year with rAd5 vectors containing the EBOV matched insert (Hensley et al., 2010).
  • Vaccine Immune Response Type: VO_0000286
  • Immune Response: DNA/rAd prime-boost EBOV immunization generated antigen-specific CD4+ T cell immunity against proteins expressed by the vaccine insert. The magnitude of antigen-specific CD4+ T cells was uniform across the four immunized macaques (Hensley et al., 2010).
  • Efficacy: DNA/rAd5 immunization of cynomolgus macaques protects against infection when animals are challenged with a virus species homologous to the vaccine inserts (Hensley et al., 2010).
6. Ebola virus DNA vaccine EBOV GP
a. Vaccine Ontology ID:
VO_0004036
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse, rabbit, guinea pig
e. Gene Engineering of GP from Zaire ebolavirus
f. Vector:
pWRG7077 (Riemenschneider et al., 2003)
g. Immunization Route
Gene gun
h. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Immune Response: The mice had low neutralizing antibody responses, yet were protected from challenge. This, as indicated by earlier studies, may be due to gene gun vaccination, which generally elicits a TH2-type response in BALB/c mice (Riemenschneider et al., 2003).
  • Efficacy: Two vaccinations with the EBOV GP DNA elicited consistently high antibody responses and conferred complete protection from EBOV challenge (Riemenschneider et al., 2003).
7. Ebola virus DNA vaccine encoding ZEBOV GP and SEBOV GP
a. Vaccine Ontology ID:
VO_0011465
b. Type:
DNA vaccine
c. Status:
Research
d. Antigen
Zaire Ebola virus GP and Sudan Ebola virus GP
e. Gene Engineering of GP from Zaire ebolavirus
  • Type: DNA vaccine construction
  • Description: DNA/rAd5 vaccines expressing ZEBOV and SEBOV glycoprotein (GP) (Hensley et al., 2010).
  • Detailed Gene Information: Click here.
f. Gene Engineering of GP from Sudan ebolavirus
  • Type: DNA vaccine construction
  • Description: DNA/rAd5 vaccines expressing ZEBOV and SEBOV glycoprotein (GP) (Hensley et al., 2010).
  • Detailed Gene Information: Click here.
g. Vector:
Replication-defective rAd5 GP vectors and p1012 (Hensley et al., 2010)
h. Immunization Route
Intramuscular injection (i.m.)
i. Macaque Response
  • Vaccination Protocol: DNA immunizations were administered by Biojector IM injection, bilateral deltoid, with a mixture of 2 mg each of two plasmid vectors encoding GP(Z) and GP(S/G). DNA immunizations were administered at 0, 4, 8, and 14 weeks. Each subject received a boost with 1011 particle units (PU) of rAd5 GP(Z) at 12 months following the final DNA priming immunization (Hensley et al., 2010).
  • Challenge Protocol: All animals were challenged by the intramuscular route with 1,000 TCID50 of BEBOV, 7 weeks post rAd5 GP boost. The challenge virus used in this study was isolated from blood specimen #200706291 from a fatal case infected during the 2007 EBOV outbreak in Bundibugyo district, Uganda. The virus was isolated on Vero E6 cells and passaged twice prior to initiating these experiments (Hensley et al., 2010).
  • Efficacy: Vaccinated subjects developed robust, antigen-specific humoral and cellular immune responses against the GP from ZEBOV as well as cellular immunity against BEBOV GP, and immunized macaques were uniformly protected against lethal challenge with BEBOV (Hensley et al., 2010).
8. Ebola virus DNA vaccine GP DNA
a. Vaccine Ontology ID:
VO_0004334
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of GP from Zaire ebolavirus
  • Type: DNA vaccine construction
  • Description: Vector pWRG7077 expressed highly glycosylated type 1 transmembrane protein (GP) (Vanderzanden et al., 1998).
  • Detailed Gene Information: Click here.
f. Vector:
pWRG7077 (Vanderzanden et al., 1998)
g. Immunization Route
PowderJect-XR gene gun
h. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: Mice were completely protected from challenge with mouse adapted EBOV with a priming dose of 0.5 microgram of GP DNA followed by three or four subsequent vaccinations with 1.5 micrograms of DNA. Partial protection could be observed for at least 9 months after three immunizations with 0.5 microgram of the GP DNA vaccine (Vanderzanden et al., 1998).
9. Ebola virus EBOV NP
a. Vaccine Ontology ID:
VO_0004037
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Rabbit, mouse, guinea pig
e. Gene Engineering of NP from Zaire Ebola virus
f. Vector:
pWRG7077 (Riemenschneider et al., 2003)
g. Immunization Route
Gene gun
h. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Immune Response: The mice had low neutralizing antibody responses, yet were protected from challenge. This, as indicated by earlier studies, may be due to gene gun vaccination, which generally elicits a TH2-type response in BALB/c mice (Riemenschneider et al., 2003).
  • Efficacy: Two vaccinations with the EBOV NP DNA elicited consistently high antibody responses and conferred complete protection from EBOV challenge (Riemenschneider et al., 2003).
10. Ebola virus recombinant adenovirus vaccine AdC7-ZGP encoding GP
a. Vaccine Ontology ID:
VO_0004382
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of GP from Zaire ebolavirus
  • Type: Recombinant vector construction
  • Description: Vector adenoviral (ADV) expressed the Ebola envelope glycoprotein (GP) (Kobinger et al., 2006).
  • Detailed Gene Information: Click here.
f. Vector:
adenoviral (ADV) vector (Kobinger et al., 2006)
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Immune Response: AdC7 vaccine stimulated robust T and B cell responses to ZEBOV in naïve mice (Kobinger et al., 2006).
  • Efficacy: Mice were immunized with a single dose of 5 × 1010 particles per animal as performed previously and vaccinated animals were challenged with 200 LD50 of the mouse-adapted strain of ZEBOV 21 days later. All control mice (vehicle and AdHu5-LacZ) died between days 5 and 9 post-challenge. In contrast, all mice vaccinated with AdC7-ZGP survived the challenge with mouse-adapted ZEBOV. Weight loss was observed only from control groups (vehicle and AdHu5-LacZ). Complete protection following vaccination with 5 × 1010 particles of AdC7-ZGP was demonstrated with challenge doses of ZEBOV up to 200,000 LD50, which was the highest dose tested (Kobinger et al., 2006).
11. Ebola virus recombinant adenovirus vector vaccine ADV−GP/NP
a. Vaccine Ontology ID:
VO_0004072
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Gene Engineering of GP from Zaire ebolavirus
  • Type: DNA vaccine construction
  • Description: Vector adenoviral (ADV) expressed Ebola glycoprotein (GP) (Sullivan et al., 2003b).
  • Detailed Gene Information: Click here.
e. Gene Engineering of NP from Zaire Ebola virus
  • Type: Recombinant vector construction
  • Description: Vector adenoviral (ADV) expressed Ebola nucleoprotein (NP) (Sullivan et al., 2003b).
  • Detailed Gene Information: Click here.
f. Preparation
To make ADV-GP, the BamHI/EcoRI fragment of GP(Z) was digested from PGEM-3Zf(-)-GP, treated with Klenow, and inserted into HindIII/XbaI/Kle/CIP-treated pRc/CMV plasmid. The resulting plasmid was digested by NruI/DraIII and treated with Klenow. The NruI/DraIII/Kle fragment containing the CMV enhancer, GP(Z) DNA and bovine growth hormone polyadenylation signal was inserted into the BgIII site of the adenoviral shuttle plasmid pAdBgIII26. The adenovirus, a first generation dl 309-based Ad5 vector, contained a deletion in E1 to render the vector replication defective and a partial deletion/substitution in E3, which disrupts the coding sequences for the E3 proteins with a relative molecular mass of 14,700, 14,500 and 10,400, respectively (Sullivan et al., 2000).
g. Virulence
h. Description
ADV−GP consists of an adenoviral (ADV) vector encoding the Ebola glycoprotein (GP) (Sullivan et al., 2003).
i. Monkey Response
  • Host Strain: Cynomolgus macaque
  • Vaccination Protocol: Cynomolgus macaques were immunized with ADV−GP and ADV−NP, followed by boosting 9 weeks later (Sullivan et al., 2003).
  • Persistence: None noted
  • Side Effects: None noted
  • Challenge Protocol: One week after the boost, animals were challenged with either a low or high dose of a 1995 isolate of Ebola virus Zaire.
  • Efficacy: In the saline-injected control animals these doses were uniformly fatal 6−12 days afterwards. In contrast, the ADV−GP/NP immunized monkeys were completely protected. Analysis of the cell-mediated and humoral immune responses revealed significant increases in the CD8+ T-cell response to Ebola antigens by intracellular cytokine staining for interferon (IFN)-, seen before exposure to virus, in contrast to control animals where no response was seen. Similarly, antibody titres to the virus were stimulated in vaccinated animals, which minimally increased after the viral challenge (Sullivan et al., 2003).
12. Ebola virus recombinant rAD-GP encoding GP
a. Vaccine Ontology ID:
VO_0004335
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Macaque
e. Gene Engineering of GP from Zaire ebolavirus
  • Type: Recombinant vector construction
  • Description: Vector rAd expressed the Ebola glycoprotein (GP) (Sullivan et al., 2006).
  • Detailed Gene Information: Click here.
f. Vector:
replication-defective adenoviral vectors (rAd) (Sullivan et al., 2006)
g. Immunization Route
Intramuscular injection (i.m.)
h. Macaque Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: Expression of specific GPs alone vectored by rAd are sufficient to confer protection against lethal challenge in a relevant nonhuman primate model (Sullivan et al., 2006).
13. Ebola virus recombinant vector vaccine Ad-CAGoptZGP encoding the envelope glycoprotein
a. Vaccine Ontology ID:
VO_0004384
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse, guinea pig
e. Gene Engineering of GP from Zaire ebolavirus
  • Type: Recombinant vector construction
  • Description: Vector Human adenovirus serotype 5 (Ad) expressed the Zaire ebolavirus (ZEBOV) envelope glycoprotein (Richardson et al., 2009).
  • Detailed Gene Information: Click here.
f. Vector:
Human adenovirus serotype 5 (Ad) (Richardson et al., 2009)
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Immune Response: Ad-CAGoptZGP at a dose of 1×105 IFU/mouse elicited a frequency of 1.3±0.3% positive IFN-γ producing CD8+ T cells. Overall, the average frequency of positive IFN-γ producing CD8+ T cells was slightly higher with a lower dose of Ad-CAGoptZGP than with a higher dose of Ad-CMVZGP (Richardson et al., 2009).
  • Efficacy: All mice vaccinated with doses of 1×104, 1×105 and 1×106 IFU/mouse of Ad-CAGoptZGP were fully protected from the viral challenge with no weight loss or other clinical signs of disease (Richardson et al., 2009).
14. Ebola virus recombinant vector vaccine Ad-CMVZGP encoding the glycoprotein
a. Vaccine Ontology ID:
VO_0004383
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of GP from Zaire ebolavirus
  • Type: Recombinant vector construction
  • Description: Vector Human adenovirus serotype 5 (Ad) expressed the Zaire ebolavirus (ZEBOV) envelope glycoprotein (Richardson et al., 2009).
  • Detailed Gene Information: Click here.
f. Vector:
Human adenovirus serotype 5 (Ad) (Richardson et al., 2009)
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Immune Response: Vaccination following viral challenge produced enhanced T and B cell immune responses with a low dose of Ad-CAGoptZGP. The frequency of IFN-γ+CD8 T cells with Ad-CMVZGP at 1×107 IFU/mouse was at 1.6±0.4%, on average (Richardson et al., 2009).
  • Efficacy: Protection following Zaire ebola virus challenge was complete in mice vaccinated with Ad-CMVZGP at 1×106 and 1×107 IFU/mouse but was only partially protective at 1×105 IFU/mouse (Richardson et al., 2009).
15. Ebola virus recombinant vector vaccine EBO7 encoding GP from SEBOV and ZEBOV
a. Vaccine Ontology ID:
VO_0004337
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Macaque
e. Gene Engineering of GP from Sudan ebolavirus
  • Type: Recombinant vector construction
  • Description: Vector CAdVax expressed GP from SEBOV (Pratt et al., 2010).
  • Detailed Gene Information: Click here.
f. Gene Engineering of GP from Zaire ebolavirus
  • Type: Recombinant vector construction
  • Description: Vector CAdVax expressed GP from ZEBOV (Pratt et al., 2010).
  • Detailed Gene Information: Click here.
g. Vector:
a bivalent rAd vector (CAdVax) (Pratt et al., 2010)
h. Immunization Route
Intramuscular injection (i.m.)
i. Macaque Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: Significantly, protection against SEBOV given as an aerosol challenge, which has not previously been shown, could be achieved with a boosting vaccination (Pratt et al., 2010).
16. Ebola virus recombinant vector vaccine pVSVXN2∆G/ZEBOVsGP encoding GP
a. Vaccine Ontology ID:
VO_0004381
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Mouse
e. Gene Engineering of GP from Zaire ebolavirus
  • Type: Recombinant vector construction
  • Description: Vector VSVXN2∆G expressed the transmembrane glycoproteins of Zaire Ebola virus (GP) (Garbutt et al., 2004).
  • Detailed Gene Information: Click here.
f. Vector:
VSVXN2∆G in vesicular stomatitis virus (Garbutt et al., 2004)
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: The rVSV expressing the Zaire Ebola virus transmembrane glycoprotein mediated protection in mice against a lethal Zaire Ebola virus challenge (Garbutt et al., 2004).
17. Ebola virus recombinant VSVΔG-GP encoding GP
a. Vaccine Ontology ID:
VO_0004336
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Macaque
e. Gene Engineering of GP from Zaire ebolavirus
  • Type: Recombinant vector construction
  • Description: Vector VSVΔG expressed GP from ZEBOV (Jones et al., 2005).
  • Detailed Gene Information: Click here.
f. Vector:
a replication competent vesicular stomatitis virus vector (VSVΔG) (Jones et al., 2005)
g. Immunization Route
Intramuscular injection (i.m.)
h. Macaque Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: A single intramuscular injection of the EBOV or MARV vaccine elicited completely protective immune responses in nonhuman primates against lethal EBOV or MARV challenges (Jones et al., 2005).
18. GP and NP
a. Vaccine Ontology ID:
VO_0004073
b. Type:
VEEV Replicon
c. Preparation
The Ebola NP and GP genes from the Mayinga strain of Ebola virus were derived from pSP64- and pGEM3Zf(-)-based plasmids. The BamHI±EcoRI (2.3 kb) and BamHI±KpnI (2.4 kb) fragments containing the NP and GP genes, respectively, were subcloned into a shuttle vector digested with BamHI and EcoRI within a polylinker sequence flanked by ClaI sites. For cloning of the GP gene, overhanging ends produced by KpnI (in the GP fragment) and EcoRI (in the shuttle vector) were made blunt by incubation with T4 DNA polymerase. From the shuttle vector, NP or GP genes were transferred as ClaI-fragments into the ClaI site of the replicon clone, resulting in plasmids encoding the NP or GP gene in place of the VEE structural protein genes (Pushko et al., 2000).
d. Virulence
e. Description
This immunogen is composed of RNA replicon particles derived from an attenuated strain of Venezuelan equine encephalitis virus (VEEV) expressing EBOV glycoprotein and nucleoprotein (Geisbert et al., 2002).
f. Monkey Response
  • Host Strain: Cynomolgus macaques
  • Vaccination Protocol: Groups of three cynomolgus macaques were vaccinated with VRP that expressed EBOV GP, EBOV NP, a mixture of EBOV GP and EBOV NP, or a control antigen (influenza hemagglutinin) that has no effect on EBOV immunity. Animals were vaccinated by subcutaneous injection of 107 focus-forming units of VRP in a total of 0.5 mL at one site. Vaccinations were repeated 28 days after the first injection and 28 days after the second (Geisbert et al., 2002).
  • Persistence: None noted
  • Side Effects: None noted
  • Efficacy: These results indicate that rodent models of EBOV hemorrhagic fever do not consistently predict efficacy of candidate vaccines in nonhuman primates, perhaps because the disease course in rodents differs from that reported in human and nonhuman primates (Geisbert et al., 2002).
  • Description: All animals, including the four untreated macaques, were challenged with 1,000 PFU of EBOV 49 days after the third vaccine dose. At postchallenge day 3, all animals became ill; two animals from each vaccination group (i.e., GP, NP, GP + NP, influenza HA) died on day 6, and the remaining animals died on day 7 (Geisbert et al., 2002).
19. GP-VRP
a. Vaccine Ontology ID:
VO_0000780
b. Type:
Recombinant vector vaccine
c. Gene Engineering of GP from Reston ebolavirus
  • Type: Protein
  • Description:
  • Detailed Gene Information: Click here.
d. Vector:
VRP: VEE replicon particle
e. Preparation
The Ebola GP genes from the Mayinga strain of Ebola virus were derived from pGEM3Zf(-)-based plasmid. The BamHI±KpnI (2.4 kb) fragment containing the GP gene was subcloned into a shuttle vector. From the shuttle vector, GP gene was transferred as ClaI-fragment into the ClaI site of the replicon clone, resulting in plasmids encoding the GP gene in place of the VEE structural protein genes (Pushko et al., 2000).
f. Virulence
g. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: VRP were diluted in PBS and administered to 6±8 week old BALB/c mice. Groups of 10 BALB/c mice were inoculated on days 0 and 28 with two doses of NP-VRP, GP-VRP, or a mixture of both. Challenge was carried out 4 weeks after final immunization with VRP. Mice were challenged i.p. with mouse-adapted Ebola virus. To determine subsequent viral titers in the serum, liver, and spleen, two mice were taken from VRP-vaccinated or control groups on each of days 1±5 after challenge, anesthetized and exsanguinated. Portions of the liver and spleen were removed aseptically, weighed, and ground in a sterile mortar. Viral titers in the sera and tissues were determined by plaque assay (Pushko et al., 2000).
  • Persistence: None noted
  • Side Effects: None
  • Efficacy: GP-VRP was effective in protecting BALB/c mice against a lethal challenge with mouse-adapted Ebola virus (Pushko et al., 2000). Nine out of ten animals vaccinated with GP-VRP were protected (Pushko et al., 2000).
h. Guinea pig Response
  • Host Strain: strain 2 and strain 13
  • Vaccination Protocol: VRP were diluted in PBS and administered to inbred, strain 2 or strain 13 guinea pigs. Groups of five guinea pigs were inoculated subcutaneously (s.c.) at day 0 with a total of 0.5 ml containing 107 IU VRP at one (strain 2) or two (strain 13) dorsal sites. Challenge was carried out 4 weeks after final immunization with VRP. Guinea pigs were challenged s.c. with 1000 LD50 of guinea pig- adapted Ebola virus. Animals were observed daily for 60 days, and morbidity (determined as changes in behavior, appearance, and weight) and survival were recorded. Blood samples were taken
    on the days indicated after challenge and viremia levels were determined by plaque assay (Pushko et al., 2000).
  • Persistence: None noted
  • Side Effects: None noted
  • Efficacy: At day 7 after challenge, both VRP-vaccinated groups had lower viremia titers than control animals. All mockvaccinated animals or NP-VRP-vaccinated animals became ill, and died at days 8±11 after challenge. However, three out of five guinea pigs vaccinated with GP-VRP showed no signs of illness and survived challenge, and the remaining two showed increased survival times. No clear relationship with survival and antibody titers was observed, as the pre-challenge ELISA and PRNT50 titers of the two GP-VRP-inoculated animals that died were equivalent to those of the three survivors (Pushko et al., 2000).
20. NP-VRP
a. Vaccine Ontology ID:
VO_0011387
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Gene Engineering of EBOV NP
  • Type: Recombinant vector construction
  • Description:
  • Detailed Gene Information: Click here.
e. Vector:
VRP: VEE replicon particle
f. Preparation
The Ebola NP gene from the Mayinga strain of Ebola virus were derived from pSP64-based plasmid. The BamHI±EcoRI (2.3 kb) fragment containing the NPgene, was subcloned into a shuttle vector digested with BamHI and EcoRI within a polylinker sequence flanked by ClaI sites. From the shuttle vector, NP gene was transferred as ClaI-fragments into the ClaI site of the replicon clone, resulting in plasmids encoding the NP gene in place of the VEE structural protein genes (Pushko et al., 2000).
g. Immunization Route
Intramuscular injection (i.m.)
h. Guinea pig Response
  • Host Strain: strain 2 and strain 13
  • Vaccination Protocol: VRP were diluted in PBS and administered to inbred, strain 2 or strain 13 guinea pigs. Groups of five guinea pigs were inoculated subcutaneously (s.c.) at day 0 with a total of 0.5 ml containing 107 IU VRP at one (strain 2) or two (strain 13) dorsal sites. Challenge was carried out 4 weeks after final immunization with VRP. Guinea pigs were challenged s.c. with 1000 LD50 of guinea pig- adapted Ebola virus. Animals were observed daily for 60 days, and morbidity (determined as changes in behavior, appearance, and weight) and survival were recorded. Blood samples were taken on the days indicated after challenge and viremia levels were determined by plaque assay (Pushko et al., 2000).
  • Efficacy: At day 7 after challenge, NP-VRP-vaccinated group had lower viremia titers than control animals. All mock vaccinated animals or NP-VRP-vaccinated animals became ill, and died at days 8±11 after challenge (Pushko et al., 2000).
i. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: VRP were diluted in PBS and administered to 6±8 week old BALB/c mice. Groups of 10 BALB/c mice were inoculated on days 0 and 28 with two doses of NP-VRP, GP-VRP, or a mixture of both. Challenge was carried out 4 weeks after final immunization with VRP. Mice were challenged i.p. with mouse-adapted Ebola virus. To determine subsequent viral titers in the serum, liver, and spleen, two mice were taken from VRP-vaccinated or control groups on each of days 1±5 after challenge, anesthetized and exsanguinated. Portions of the liver and spleen were removed aseptically, weighed, and ground in a sterile mortar. Viral titers in the sera and tissues were determined by plaque assay (Pushko et al., 2000).
  • Efficacy: NP-VRP was effective in protecting BALB/c mice against a lethal challenge with mouse-adapted Ebola virus (Pushko et al., 2000). All mice vaccinated with NP-VRP survived the challenge with no signs of illness (Pushko et al., 2000).
21. rAd-GP (Ebola virus)
a. Vaccine Ontology ID:
VO_0004631
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Gene Engineering of GP from Zaire ebolavirus
  • Type: Recombinant protein preparation
  • Description:
  • Detailed Gene Information: Click here.
f. Vector:
(O'Brien et al., 2014)
g. Preparation
(O'Brien et al., 2014)
h. Immunization Route
Intramuscular injection (i.m.)
i. Mouse Response
  • Host Strain: IFNR(-/-) mice
  • Vaccine Immune Response Type: VO_0003057
  • Immune Response: the antibody response in IFNR(-/-) mice was similar to that observed in vaccinated wild-type mice (O'Brien et al., 2014).
  • Efficacy: The recombinant vaccines elicited good levels of protection in the knock-out mouse (O'Brien et al., 2014).
22. rCMV- EBOV
a. Vaccine Ontology ID:
VO_0004717
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Gene Engineering of NP from Zaire Ebola virus
  • Type: Recombinant protein preparation
  • Description: A mouse CMV (MCMV) vector expressing a CD8+ T cell epitope from the nucleoprotein (NP) of Zaire ebolavirus (ZEBOV) (MCMV/ZEBOV-NP(CTL)) (Tsuda et al., 2011).
  • Detailed Gene Information: Click here.
f. Preparation
A mouse CMV (MCMV) vector expressing a CD8+ T cell epitope from the nucleoprotein (NP) of Zaire ebolavirus (ZEBOV) (MCMV/ZEBOV-NP(CTL)) (Tsuda et al., 2011).
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Vaccination Protocol: Mice were vaccinated with rCMV- EBOV (Tsuda et al., 2011).
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: Mice were challenged with a lethal dose of ZEBOV (Tsuda et al., 2011).
  • Efficacy: The vaccine induced high levels of long-lasting (>8 months) CD8+ T cells against ZEBOV NP in mice. Importantly, all vaccinated animals were protected against lethal ZEBOV challenge (Tsuda et al., 2011).
23. rVEE-Ebola-NP
a. Vaccine Ontology ID:
VO_0004805
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Antigen
Ebola virus nucleoprotein (NP) (Wilson and Hart, 2001)
f. Gene Engineering of NP from Zaire Ebola virus
  • Type: Recombinant vector construction
  • Description:
  • Detailed Gene Information: Click here.
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Host Strain: C57BL/6
  • Vaccine Immune Response Type: VO_0003057
  • Efficacy: C57BL/6 mice vaccinated with Venezuelan equine encephalitis virus replicons encoding the Ebola virus nucleoprotein (NP) survived lethal challenge with Ebola virus (Wilson and Hart, 2001).
24. rVSV- SEBOV-GP and -VP40
a. Vaccine Ontology ID:
VO_0004661
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Gene Engineering of NP from Zaire Ebola virus
  • Type: Recombinant vector construction
  • Description: New vectors were generated that contain EBOV viral protein 40 (VP40) or EBOV nucleoprotein (NP) as a second antigen expressed by the same rVSV vector that encodes the heterologous GP (Marzi et al., 2011).
  • Detailed Gene Information: Click here.
f. Gene Engineering of VP40 from Zaire ebolavirus
  • Type: Recombinant vector construction
  • Description: New vectors were generated that contain EBOV viral protein 40 (VP40) or EBOV nucleoprotein (NP) as a second antigen expressed by the same rVSV vector that encodes the heterologous GP (Marzi et al., 2011).
  • Detailed Gene Information: Click here.
g. Preparation
rVSV-expressing SEBOV-GP and -VP40 (Marzi et al., 2011; Falzarano et al., 2011).
h. Immunization Route
Intramuscular injection (i.m.)
i. Guinea pig Response
  • Vaccination Protocol: The guinea pigs were vaccinated intraperitoneally with a single dose of 2 ×105 PFU to guinea pigs of rVSV (Marzi et al., 2011).
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: The guinea pigs were subsequently challenged with 1000 LD50 of GPA-ZEBOV [20] or boosted with the same dose of rVSV and challenged 3 weeks later (Marzi et al., 2011).
  • Efficacy: After applying a 2-dose immunization approach, we observed an improved cross-protection rate, with 5 of 6 guinea pigs surviving the lethal ZEBOV challenge if vaccinated with rVSV-expressing SEBOV-GP and -VP40 (Marzi et al., 2011).
25. rVSV-EBOV
a. Vaccine Ontology ID:
VO_0004660
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Gene Engineering of GP from Zaire ebolavirus
  • Type: Recombinant vector construction
  • Description: The recombinant vesicular stomatitis virus (rVSV) vector-based monovalent vaccine platform expressing a glycoprotein of Zaire ebolavirus (ZEBOV) (Falzarano et al., 2011).
  • Detailed Gene Information: Click here.
f. Gene Engineering of GP from Cote d'Ivoire Ebola virus
  • Type: Recombinant vector construction
  • Description: The recombinant vesicular stomatitis virus (rVSV) vector-based monovalent vaccine platform expressing a glycoprotein of Côte d’Ivoire ebolavirus (CIEBOV) (Falzarano et al., 2011).
  • Detailed Gene Information: Click here.
g. Preparation
A recombinant vesicular stomatitis virus (rVSV) vector-based monovalent vaccine platform expressing a filovirus glycoprotein (Falzarano et al., 2011).
h. Immunization Route
Intramuscular injection (i.m.)
i. Macaque Response
  • Vaccination Protocol: Cynomolgus macaques were vaccinated with an rVSV vaccine expressing either the glycoprotein of Zaire ebolavirus (ZEBOV) or Côte d'Ivoire ebolavirus (CIEBOV) (Falzarano et al., 2011).
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: The macaques were challenged with Bundibugyo ebolavirus (BEBOV)(Falzarano et al., 2011).
  • Efficacy: A single vaccination with the ZEBOV-specific vaccine provided cross-protection (75% survival) against subsequent BEBOV challenge, whereas vaccination with the CIEBOV-specific vaccine resulted in an outcome similar to mock-immunized animals (33% and 25% survival, respectively) (Falzarano et al., 2011).
26. VRP expressing VP24
a. Vaccine Ontology ID:
VO_0000781
b. Type:
VEEV replicon
c. Gene Engineering of VP24 from Zaire ebolavirus
  • Type: Protein
  • Description:
  • Detailed Gene Information: Click here.
d. Vector:
VRP: virus-like replicon particle
e. Preparation
Replicon RNAs were packaged into particles. Briefly, capped replicon RNAs were produced in vitro by T7 runoff transcription of NotI-digested plasmid templates using the RiboMAX T7 RNA polymerase kit. BHK cells were cotransfected with the replicon RNAs and two RNAs expressing the VEE virus structural proteins. The cell culture supernatants were harvested approximately 30 h after transfection and the replicon particles were concentrated and partially purified by centrifugation through a 20% sucrose cushion. Packaged VRPs were suspended in phosphatebuffered saline and titers were determined as immunofluorescent foci after infection of Vero cells as described using either EBOV-immune rabbit serum or mouse monoclonal antibodies to VP24 (Z-AC01-BG11-01), VP35 (M-HC01-AF11), or VP40 (M-HD06-AD10) (Wilson et al., 2001).
f. Virulence
g. Description
VP24 is an Ebola virus protein. It is membrane associated and is most likely located on the inside of the membrane. The function of VP24 is not known but it may serve as a minor matrix protein, facilitating the interaction of VP40 and/or GP with the RNP complex, or function in the uncoating of the virion during infection (Wilson et al., 2001).
h. Mouse Response
  • Host Strain: BALB/c and C57BL/6
  • Vaccination Protocol: Groups of 10 BALB/c or C57BL/6 mice per experiment were subcutaneously injected at the base of the neck with 2(106) focus-forming units of VRPs encoding the EBOV-Z genes, or with a control replicon encoding the Lassa N gene. Booster immunizations were administered at 1-month intervals (Wilson et al., 2001).
  • Persistence: None noted
  • Side Effects: None noted
  • Efficacy: Vaccination with VRPs encoding the EBOV-Z VP24 protein protected the majority (90±95%) of the BALB/c mice from lethal EBOV challenge. In a similar experiment, two inoculations of VRPs encoding the EBOV-Z VP24 protein also protected 5/5 BALB/c mice from a 3(104) LD50 challenge dose and 5/5 BALB/c mice from a 3(106) LD50 challenge dose. None of the C57BL/6 mice were protected. Most of the mice had detectable EBOV-Z-specific serum antibodies after vaccination with VRPs encoding the EBOV-Z VP protein (Wilson et al., 2001). These results indicate that the VP24 protein may be an important component of a vaccine designed to protect humans from Ebola hemorrhagic fever.
27. VRP expressing VP30
a. Vaccine Ontology ID:
VO_0000782
b. Type:
Recombinant vector vaccine
c. Gene Engineering of VP30 from Zaire ebolavirus
  • Type: Protein
  • Description:
  • Detailed Gene Information: Click here.
d. Vector:
VRP: virus-like replicon particle
e. Preparation
Replicon RNAs were packaged into particles. Briefly, capped replicon RNAs were produced in vitro by T7 runoff transcription of NotI-digested plasmid templates using the RiboMAX T7 RNA polymerase kit. BHK cells were cotransfected with the replicon RNAs and two RNAs expressing the VEE virus structural proteins. The cell culture supernatants were harvested approximately 30 h after transfection and the replicon particles were concentrated and partially purified by centrifugation through a 20% sucrose cushion. Packaged VRPs were suspended in phosphatebuffered saline and titers were determined as immunofluorescent foci after infection of Vero cells as described using either EBOV-immune rabbit serum or mouse monoclonal antibodies to VP24 (Z-AC01-BG11-01), VP35 (M-HC01-AF11), or VP40 (M-HD06-AD10) (Wilson et al., 2001).
f. Virulence
g. Description
VP30 is an Ebola virus protein. It associates with the genomic RNA in a ribonucleoprotein complex. The VP30 protein is not essential for replication, but it is necessary for efficient transcription in this system. It has also recently been shown to be essential for the recovery of infectious EBOV-Z from cloned cDNAs (Wilson et al., 2001).
h. Mouse Response
  • Host Strain: BALB/c and C57BL/6
  • Vaccination Protocol: Groups of 10 BALB/c or C57BL/6 mice per experiment were subcutaneously injected at the base of the neck with 2(106) focus-forming units of VRPs encoding the EBOV-Z genes, or with a control replicon encoding the Lassa N gene. Booster immunizations were administered at 1-month intervals (Wilson et al., 2001).
  • Persistence: None noted
  • Side Effects: None noted
  • Efficacy: Three injections of VRPs encoding EBOV-Z VP30 induced protection from lethal disease in 85% of the BALB/c mice examined. However, when the vaccination schedule was decreased to two injections, only 55% of the mice immunized with VP30 survived challenge. None of the C57BL/6 mice were protected. Most of the mice had detectable EBOV-Z-specific serum antibodies after vaccination with VRPs encoding the EBOV-Z VP protein (Wilson et al., 2001). These results indicate that the VP30 protein may be an important component of a vaccine designed to protect humans from Ebola hemorrhagic fever (Wilson et al., 2001).
28. VRP expressing VP35
a. Vaccine Ontology ID:
VO_0000783
b. Type:
Recombinant vector vaccine
c. Gene Engineering of VP35 from Zaire ebolavirus
  • Type: Protein
  • Description:
  • Detailed Gene Information: Click here.
d. Vector:
VRP: virus-like replicon particle
e. Preparation
Replicon RNAs were packaged into particles. Briefly, capped replicon RNAs were produced in vitro by T7 runoff transcription of NotI-digested plasmid templates using the RiboMAX T7 RNA polymerase kit. BHK cells were cotransfected with the replicon RNAs and two RNAs expressing the VEE virus structural proteins. The cell culture supernatants were harvested approximately 30 h after transfection and the replicon particles were concentrated and partially purified by centrifugation through a 20% sucrose cushion. Packaged VRPs were suspended in phosphatebuffered saline and titers were determined as immunofluorescent foci after infection of Vero cells as described using either EBOV-immune rabbit serum or mouse monoclonal antibodies to VP24 (Z-AC01-BG11-01), VP35 (M-HC01-AF11), or VP40 (M-HD06-AD10) (Wilson et al., 2001).
f. Virulence
g. Description
VP35 is an Ebola virus protein. It associates with the genomic RNA in a ribonucleoprotein complex. It is essential for replication and encapsidation of the EBOV genome. The VP35 protein has also recently been shown to be essential for the recovery of infectious EBOV-Z from cloned cDNAs. In addition to being an essential component of the replication complex, VP35 was also recently implicated as an interferon antagonist. VP35 may therefore facilitate viral replication in infected cells by blocking the induction of antiviral immune responses normally induced by the production of interferon (Wilson et al., 2001).
h. Mouse Response
  • Host Strain: BALB/c and C57BL/6
  • Vaccination Protocol: Groups of 10 BALB/c or C57BL/6 mice per experiment were subcutaneously injected at the base of the neck with 2(106) focus-forming units of VRPs encoding the EBOV-Z genes, or with a control replicon encoding the Lassa N gene. Booster immunizations were administered at 1-month intervals (Wilson et al., 2001).
  • Persistence: None noted
  • Side Effects: None noted
  • Efficacy: The VP35 protein was not efficacious in the BALB/c mouse model, as only 20 and 26% of the mice were protected from lethal challenge after either two or three doses, respectively. The mean day of death of the VP-vaccinated mice that succumbed to the EBOV challenge was within 1 day of the control Lassa N-vaccinated mice. C57BL/6 mice were protected from lethal EBOV challenge after vaccination with the EBOV-Z VP35 protein, with 70% of the mice protected after three inoculations. When the viral titers were measured 5 days after challenge, vaccination with VRPs encoding the EBOV-Z VP35 protein reduced the viral load by at least 4 log10 compared to control mice. Most of the mice had detectable EBOV-Z-specific serum antibodies after vaccination with VRPs encoding the EBOV-Z VP protein (Wilson et al., 2001). These results indicate that the VP35 protein may be an important component of a vaccine designed to protect humans from Ebola hemorrhagic fever (Wilson et al., 2001).
29. VRP expressing VP40
a. Vaccine Ontology ID:
VO_0000784
b. Type:
Recombinant vector vaccine
c. Gene Engineering of VP40 from Zaire ebolavirus
  • Type: Protein
  • Description:
  • Detailed Gene Information: Click here.
d. Vector:
VRP: virus-like replicon particle
e. Preparation
Replicon RNAs were packaged into particles. Briefly, capped replicon RNAs were produced in vitro by T7 runoff transcription of NotI-digested plasmid templates using the RiboMAX T7 RNA polymerase kit. BHK cells were cotransfected with the replicon RNAs and two RNAs expressing the VEE virus structural proteins. The cell culture supernatants were harvested approximately 30 h after transfection and the replicon particles were concentrated and partially purified by centrifugation through a 20% sucrose cushion. Packaged VRPs were suspended in phosphatebuffered saline and titers were determined as immunofluorescent foci after infection of Vero cells as described using either EBOV-immune rabbit serum or mouse monoclonal antibodies to VP40 (M-HD06-AD10) (Wilson et al., 2001).
f. Virulence
g. Description
VP40 is an Ebola virus protein. It is membrane-associated and is most likely located on the inside of the membrane. VP40 has been shown to associate with cell membranes, where it is believed to be involved in maturation of the virus by inducing viral assembly at the plasma membrane of infected cells (Wilson et al., 2001).
h. Mouse Response
  • Host Strain: BALB/c and C57BL/6
  • Vaccination Protocol: Groups of 10 BALB/c or C57BL/6 mice per experiment were subcutaneously injected at the base of the neck with 2 x106 focus-forming units of VRPs encoding the EBOV-Z genes, or with a control replicon encoding the Lassa N gene. Booster immunizations were administered at 1-month intervals (Wilson et al., 2001).
  • Persistence: None noted
  • Side Effects: None noted
  • Efficacy: Vaccination with VRPs encoding the VP40 protein protected 85 and 70% of the BALB/c mice after either two or three injections, respectively. None of the C57BL/6 mice were protected, however most of the mice had detectable EBOV-Z-specific serum antibodies after vaccination with VRPs encoding the EBOV-Z VP protein (Wilson et al., 2001). These results indicate that the VP30 protein may be an important component of a vaccine designed to protect humans from Ebola hemorrhagic fever.
IV. References
1. Bukreyev et al., 2006: Bukreyev A, Yang L, Zaki SR, Shieh WJ, Rollin PE, Murphy BR, Collins PL, Sanchez A. A single intranasal inoculation with a paramyxovirus-vectored vaccine protects guinea pigs against a lethal-dose Ebola virus challenge. Journal of virology. 2006; 80(5); 2267-2279. [PubMed: 16474134].
2. Falzarano et al., 2011: Falzarano D, Feldmann F, Grolla A, Leung A, Ebihara H, Strong JE, Marzi A, Takada A, Jones S, Gren J, Geisbert J, Jones SM, Geisbert TW, Feldmann H. Single immunization with a monovalent vesicular stomatitis virus-based vaccine protects nonhuman primates against heterologous challenge with Bundibugyo ebolavirus. The Journal of infectious diseases. 2011; 204 Suppl 3; S1082-1089. [PubMed: 21987745].
3. Feldmann et al., 2003: Feldmann H, Jones S, Klenk HD, Schnittler HJ. Ebola virus: from discovery to vaccine. Nature reviews. Immunology. 2003 Aug; 3(8); 677-85. [PubMed: 12974482].
4. Garbutt et al., 2004: Garbutt M, Liebscher R, Wahl-Jensen V, Jones S, Möller P, Wagner R, Volchkov V, Klenk HD, Feldmann H, Ströher U. Properties of replication-competent vesicular stomatitis virus vectors expressing glycoproteins of filoviruses and arenaviruses. Journal of virology. 2004; 78(10); 5458-5465. [PubMed: 15113924].
5. Garufi et al., 2012: Garufi G, Wang YT, Oh SY, Maier H, Missiakas DM, Schneewind O. Sortase-conjugation generates a capsule vaccine that protects guinea pigs against Bacillus anthracis. Vaccine. 2012; 30(23); 3435-3444. [PubMed: 22449424].
6. Geisbert et al., 2002: Geisbert TW, Pushko P, Anderson K, Smith J, Davis KJ, Jahrling PB. Evaluation in nonhuman primates of vaccines against Ebola virus. Emerging infectious diseases. 2002 May; 8(5); 503-7. [PubMed: 11996686].
7. Hensley et al., 2010: Hensley LE, Mulangu S, Asiedu C, Johnson J, Honko AN, Stanley D, Fabozzi G, Nichol ST, Ksiazek TG, Rollin PE, Wahl-Jensen V, Bailey M, Jahrling PB, Roederer M, Koup RA, Sullivan NJ. Demonstration of cross-protective vaccine immunity against an emerging pathogenic Ebolavirus Species. PLoS pathogens. 2010; 6(5); e1000904. [PubMed: 20502688].
8. Jones et al., 2005: Jones SM, Feldmann H, Ströher U, Geisbert JB, Fernando L, Grolla A, Klenk HD, Sullivan NJ, Volchkov VE, Fritz EA, Daddario KM, Hensley LE, Jahrling PB, Geisbert TW. Live attenuated recombinant vaccine protects nonhuman primates against Ebola and Marburg viruses. Nature medicine. 2005; 11(7); 786-790. [PubMed: 15937495].
9. Kobinger et al., 2006: Kobinger GP, Feldmann H, Zhi Y, Schumer G, Gao G, Feldmann F, Jones S, Wilson JM. Chimpanzee adenovirus vaccine protects against Zaire Ebola virus. Virology. 2006; 346(2); 394-401. [PubMed: 16356525].
10. Martin et al., 2006: Martin JE, Sullivan NJ, Enama ME, Gordon IJ, Roederer M, Koup RA, Bailer RT, Chakrabarti BK, Bailey MA, Gomez PL, Andrews CA, Moodie Z, Gu L, Stein JA, Nabel GJ, Graham BS. A DNA vaccine for Ebola virus is safe and immunogenic in a phase I clinical trial. Clinical and vaccine immunology : CVI. 2006; 13(11); 1267-1277. [PubMed: 16988008].
11. Marzi et al., 2011: Marzi A, Ebihara H, Callison J, Groseth A, Williams KJ, Geisbert TW, Feldmann H. Vesicular stomatitis virus-based Ebola vaccines with improved cross-protective efficacy. The Journal of infectious diseases. 2011; 204 Suppl 3; S1066-1074. [PubMed: 21987743].
12. Meln et al., 2017: Meln K, Kakkola L, He F, Airenne K, Vapalahti O, Karlberg H, Mirazimi A, Julkunen I. Production, purification and immunogenicity of recombinant Ebola virus proteins - A comparison of Freund's adjuvant and adjuvant system 03. Journal of virological methods. 2017; 242; 35-45. [PubMed: 28025125].
13. O'Brien et al., 2014: O'Brien LM, Stokes MG, Lonsdale SG, Maslowski DR, Smither SJ, Lever MS, Laws TR, Perkins SD. Vaccination with recombinant adenoviruses expressing Ebola virus glycoprotein elicits protection in the interferon alpha/beta receptor knock-out mouse. Virology. 2014; 452-453; 324-333. [PubMed: 24461913].
14. Pratt et al., 2010: Pratt WD, Wang D, Nichols DK, Luo M, Woraratanadharm J, Dye JM, Holman DH, Dong JY. Protection of nonhuman primates against two species of Ebola virus infection with a single complex adenovirus vector. Clinical and vaccine immunology : CVI. 2010; 17(4); 572-581. [PubMed: 20181765].
15. Pushko et al., 2000: Pushko P, Bray M, Ludwig GV, Parker M, Schmaljohn A, Sanchez A, Jahrling PB, Smith JF. Recombinant RNA replicons derived from attenuated Venezuelan equine encephalitis virus protect guinea pigs and mice from Ebola hemorrhagic fever virus. Vaccine. 2000 Aug 15; 19(1); 142-53. [PubMed: 10924796].
16. Richardson et al., 2009: Richardson JS, Yao MK, Tran KN, Croyle MA, Strong JE, Feldmann H, Kobinger GP. Enhanced protection against Ebola virus mediated by an improved adenovirus-based vaccine. PloS one. 2009; 4(4); e5308. [PubMed: 19390586].
17. Riemenschneider et al., 2003: Riemenschneider J, Garrison A, Geisbert J, Jahrling P, Hevey M, Negley D, Schmaljohn A, Lee J, Hart MK, Vanderzanden L, Custer D, Bray M, Ruff A, Ivins B, Bassett A, Rossi C, Schmaljohn C. Comparison of individual and combination DNA vaccines for B. anthracis, Ebola virus, Marburg virus and Venezuelan equine encephalitis virus. Vaccine. 2003; 21(25-26); 4071-4080. [PubMed: 12922144].
18. Sheets et al., 2006: Sheets RL, Stein J, Manetz TS, Duffy C, Nason M, Andrews C, Kong WP, Nabel GJ, Gomez PL. Biodistribution of DNA plasmid vaccines against HIV-1, Ebola, Severe Acute Respiratory Syndrome, or West Nile virus is similar, without integration, despite differing plasmid backbones or gene inserts. Toxicological sciences : an official journal of the Society of Toxicology. 2006; 91(2); 610-619. [PubMed: 16569729].
19. Sullivan et al., 2000: Sullivan NJ, Sanchez A, Rollin PE, Yang ZY, Nabel GJ. Development of a preventive vaccine for Ebola virus infection in primates. Nature. 2000 Nov 30; 408(6812); 605-9. [PubMed: 11117750].
20. Sullivan et al., 2003a: Sullivan N, Yang ZY, Nabel GJ. Ebola virus pathogenesis: implications for vaccines and therapies. Journal of virology. 2003 Sep; 77(18); 9733-7. [PubMed: 12941881].
21. Sullivan et al., 2003b: Sullivan NJ, Geisbert TW, Geisbert JB, Xu L, Yang ZY, Roederer M, Koup RA, Jahrling PB, Nabel GJ. Accelerated vaccination for Ebola virus haemorrhagic fever in non-human primates. Nature. 2003 Aug 7; 424(6949); 681-4. [PubMed: 12904795].
22. Sullivan et al., 2006: Sullivan NJ, Geisbert TW, Geisbert JB, Shedlock DJ, Xu L, Lamoreaux L, Custers JH, Popernack PM, Yang ZY, Pau MG, Roederer M, Koup RA, Goudsmit J, Jahrling PB, Nabel GJ. Immune protection of nonhuman primates against Ebola virus with single low-dose adenovirus vectors encoding modified GPs. PLoS medicine. 2006; 3(6); e177. [PubMed: 16683867].
23. Swenson et al., 2005: Swenson DL, Warfield KL, Negley DL, Schmaljohn A, Aman MJ, Bavari S. Virus-like particles exhibit potential as a pan-filovirus vaccine for both Ebola and Marburg viral infections. Vaccine. 2005; 23(23); 3033-3042. [PubMed: 15811650].
24. Swenson et al., 2008: Swenson DL, Wang D, Luo M, Warfield KL, Woraratanadharm J, Holman DH, Dong JY, Pratt WD. Vaccine to confer to nonhuman primates complete protection against multistrain Ebola and Marburg virus infections. Clinical and vaccine immunology : CVI. 2008; 15(3); 460-467. [PubMed: 18216185].
25. Tsuda et al., 2011: Tsuda Y, Caposio P, Parkins CJ, Botto S, Messaoudi I, Cicin-Sain L, Feldmann H, Jarvis MA. A replicating cytomegalovirus-based vaccine encoding a single Ebola virus nucleoprotein CTL epitope confers protection against Ebola virus. PLoS neglected tropical diseases. 2011; 5(8); e1275. [PubMed: 21858240].
26. Vanderzanden et al., 1998: Vanderzanden L, Bray M, Fuller D, Roberts T, Custer D, Spik K, Jahrling P, Huggins J, Schmaljohn A, Schmaljohn C. DNA vaccines expressing either the GP or NP genes of Ebola virus protect mice from lethal challenge. Virology. 1998 Jun 20; 246(1); 134-44. [PubMed: 9657001].
27. Wang et al., 2006: Wang D, Raja NU, Trubey CM, Juompan LY, Luo M, Woraratanadharm J, Deitz SB, Yu H, Swain BM, Moore KM, Pratt WD, Hart MK, Dong JY. Development of a cAdVax-based bivalent ebola virus vaccine that induces immune responses against both the Sudan and Zaire species of Ebola virus. Journal of virology. 2006; 80(6); 2738-2746. [PubMed: 16501083].
28. Warfield et al., 2005: Warfield KL, Olinger G, Deal EM, Swenson DL, Bailey M, Negley DL, Hart MK, Bavari S. Induction of humoral and CD8+ T cell responses are required for protection against lethal Ebola virus infection. Journal of immunology (Baltimore, Md. : 1950). 2005; 175(2); 1184-1191. [PubMed: 16002721].
29. Wilson and Hart, 2001: Wilson JA, Hart MK. Protection from Ebola virus mediated by cytotoxic T lymphocytes specific for the viral nucleoprotein. Journal of virology. 2001; 75(6); 2660-2664. [PubMed: 11222689].
30. Wilson et al., 2001: Wilson JA, Bray M, Bakken R, Hart MK. Vaccine potential of Ebola virus VP24, VP30, VP35, and VP40 proteins. Virology. 2001 Aug 1; 286(2); 384-90. [PubMed: 11485406].
31. Xu et al., 1998: Xu L, Sanchez A, Yang Z, Zaki SR, Nabel EG, Nichol ST, Nabel GJ. Immunization for Ebola virus infection. Nature medicine. 1998 Jan; 4(1); 37-42. [PubMed: 9427604].