VIOLIN: Vaccine Investigation and Online Information Network

Orf Virus

Table of Contents

General Information
Vaccine Related Pathogen Genes
1. ORFV011 (Protective antigen)
2. ORFV059 (Protective antigen)
Vaccine Information
References

I. General Information

1. NCBI Taxonomy ID:

10258

2. Disease:

Orf disease, Sore mouth (Ovine Ecthyma)

3. Introduction

Orf is an exanthemous disease caused by a parapox virus and occurring primarily in sheep and goats. It is also known as contagious pustular dermatitis, infectious labial dermatitis, ecthyma contagiosum, and sheep pox, thistle disease and scabby mouth. Orf virus can also infect humans. It has been recorded since the late 19th century and has been reported from most sheep- or goat-raising areas including those in Europe, the Middle East, the United States, Africa, Asia, Alaska, South America, Canada, New Zealand and Australia. Orf is spread by fomites and direct contact. In some environments infection is injected by scratches from thistles of both growing and felled plants. Symptoms include papules and pustules on the lips and muzzle, and less commonly in the mouth of young lambs and on the eyelids, feet, and teats of ewes. The lesions progress to thick crusts which may bleed. Orf in the mouths of lambs may prevent suckling and cause weight loss, and can infect the udder of the mother ewe, thus potentially leading to mastitis. Sheep are prone to reinfection. Occasionally the infection can be extensive and persistent if the animal does not produce an immune response (Wiki: Orf disease).

4. Host Ranges and Animal Models

Primarily, orf is a disease of sheep and goats although it has been reported as a natural disease in the following: humans, steenbok and alpacas, chamois and thar, reindeer, musk ox, the dog, the cat, the mountain goat, bighorn sheep, dall sheep, and the red squirrel (Wiki: Orf disease).

II. Vaccine Related Pathogen Genes

1. ORFV011

Gene Name : ORFV011
Sequence Strain (Species/Organism) : Orf Virus
NCBI Protein GI : AGY41811
Other Database IDs : CDD:177506
CDD:197205
CDD:301585
CDD:197546
CDD:197206
Taxonomy ID : 10258
Protein Name : ORFV011
Protein pI : 6.42
Protein Weight : 38341
Protein Length : 417
Protein Note : palmytilated EEV membrane glycoprotein; Provisional

Protein Sequence : Show Sequence

>AGY41811.1 ORFV011 [Orf virus]
MWPFSSIPVGADCRVVETLPAEVASLAQGNMSTLDCFTAIAESAKKFLYICSFCCNLSSTKEGVDVKDKL
CTLAKEGVDVTLLVDVQSKDKDADELREAGVNYYKVKVSTREGVGNLLGSFWISDAGHWYVGSASLTGGS
VSTIKNLGLYSTNKHLAWDLMNRYNTFYSMIVEPKVPFTRLCCAVVTPTATNFHLNHSGGGVFFSDSPER
FLGFYRTLDEDLVLHRIENAKNSIDLSLLSMVPVIKHAGAVEYWPRIIDALLRAAIDRGVRVRVIITEWK
NADPLSVSAARSLDDFGVGSVDMSVRKFVVPGRDDAANNTKLLIVDDTFAHLTVANLDGTHYRYHAFVSV
NAEKGDIVKDLSAVFERDWRSEFCKPIN

Molecule Role : Protective antigen
Molecule Role Annotation : (Zhao et al., 2011)

2. ORFV059

Gene Name : ORFV059
Sequence Strain (Species/Organism) : Orf Virus
NCBI Protein GI : ALF04630
Other Database IDs : CDD:222919
Taxonomy ID : 10258
Protein Name : ORFV059
Protein pI : 5.7
Protein Weight : 35132.14
Protein Length : 387
Protein Note : ORF059 IMV protein VP55; Provisional

Protein Sequence : Show Sequence

>ALF04630.1 ORFV059, partial [Orf virus]
MDPPEITAYIIGVAEGRGTKEVFPTLPYLVGLADDPPKPQPAPAPSPAPAPAPSPAPAPSPAPAPAPKPS
PPAPHPKGDHVLKAVEWKDVDSKDYPHFFTDMCKSTCPKEMQRRAAHHLNLWESISAGTVSTKYSDDDFI
LVVDNDMTFRKPEMVKPLIEAMKTNGWYMAQLKETYMTGALATNVPGTGDPELMVYPGGYDVSLDAYIIN
VGGMKKLYDAIIKDGGLRSGLLTEVFTLEKRLSLARVVLSGAEQVVYPEYYIQVKTRLGGAPSLWSLLAT
WLARFWPGAIYFLTTPLFSFMGLFDVDVVDVFILAYLLVLVLLLPNSRLLWFIAGLLVTA

Molecule Role : Protective antigen
Molecule Role Annotation : (Zhao et al., 2011)

III. Vaccine Information

1. Orf Virus Vaccine PBK-asd

a. Type:

DNA vaccine

b. Status:

Research

c. Host Species for Licensed Use:

None

d. Antigen

B2L protein and Kisspeptin-54 (neuropeptide) (Wassie et al., 2019)

e. Preparation

The PVAX-asd plasmid was prepared by excising the kanamycin antibiotic resistance gene from PVAX1 plasmid and replaced by aspartate-β- semialdehyde dehydrogenase (ASD) gene. The orf virus isolate MT-05 B2L gene, GenBankTM accession number JN613809.1 was chemically synthesized and subcloned into PVAX-asd plasmid with NheI and BamHI restriction enzymes. The positive plasmid was identified by restriction digestion and confirmed by sequencing. Finally, the fusion plasmid labeled as PVAX-B2L-asd and stored in −20 °C. The recombinant B2L and kisspeptin-54 plasmid was constructed by subcloning the kisspeptin-54 into PVAX-B2L-asd plasmid. Briefly, the KISS1 gene and subcloned into PVAX-B2L-asd plasmid with BamHI and EcoRI restriction enzymes. The (G4S)3 linker was used to improve and maintain the folding, expression, and biological activity of the fusion protein. This recombinant plasmid labeled as PVAX-B2L-(G4S) 3-kisspeptin-54-asd (PBK-asd). (Wassie et al., 2019)

f. Immunization Route

Intramuscular injection (i.m.)

g. Description

Recombinant B2L and Kisspeptin-54 DNA vaccine induces immunity against Orf Virus in mice

h. Mouse Response

Vaccination Protocol: The experiment was performed in the completely randomized design, and 36 rats were equally assigned into one of the following three groups: PBK-asd, PK-asd and PVAX-asd (control). Both the treatments and the control group rats were treated with (100 μg/dose) plasmid diluted in 1 ml saline. The injection was given through intramuscular route. All treatment rats were boosted twice at an interval of 3 weeks. (Wassie et al., 2019)
Immune Response: he ELISA results showed that the anti-B2L antibody was significantly higher in the PBK-asd group than in the control group from the 4th week after the initial immunization until the end of the experiment (p < 0.05). This data suggesting that immunization of rats using recombinant B2L and kisspeptin-54 DNA vaccine could stimulate antibody production against orf virus envelope protein (B2L). Rats inoculated with PBK-asd vaccine up-regulated antigen-mediated splenocyte proliferation and significantly raised antigen-specific tumor necrosis factor-alpha (TNFα-), interferon-gamma (IFN-ϒ) and interleukin (IL-2) compared to the control group (p < 0.05). (Wassie et al., 2019)
Efficacy: The capability of the vaccine to induce both humoral and cell-mediated immune response defines its efficacy. Our results showed that the recombinant PBK-asd vaccine induced a strong antigen-specific humoral ant-orf antibody after booster immunization. (Wassie et al., 2019)

2. Ovine Ecthyma Live Virus Vaccine

a. Manufacturer:

Colorado Serum Company

b. Vaccine Ontology ID:

VO_0004209

c. Type:

Live vaccine

d. Status:

Licensed

e. Location Licensed:

USA

f. Host Species for Licensed Use:

Sheep

3. Ovine Ecthyma Live Virus Vaccine

a. Manufacturer:

Texas Agricultural Experiment Station

b. Vaccine Ontology ID:

VO_0004210