Fowlpox virus |
Table of Contents |
- General Information
- NCBI Taxonomy ID
- Disease
- Introduction
- Host Ranges and Animal Models
- Host Protective Immunity
- Vaccine Related Pathogen Genes
- L1
(Protective antigen)
- Vaccine Information
- Avian Encephalomyelitis-Chicken Anemia Virus-Fowl Pox Live & Modified Live Virus Vaccine (USDA: 10T1.40)
- Avian Encephalomyelitis-Fowl Pox Live Virus Vaccine (USDA: 10M1.10 )
- Avian Encephalomyelitis-Fowl Pox Live Virus Vaccine (USDA: 10M1.11)
- Avian Encephalomyelitis-Fowl Pox Live Virus Vaccine (USDA: 10M1.13)
- Avian Encephalomyelitis-Fowl Pox Live Virus Vaccine (USDA: 10M1.14)
- Avian Encephalomyelitis-Fowl Pox Live Virus Vaccine (USDA: 10M1.40)
- Avian Encephalomyelitis-Fowl Pox-Laryngotracheitis Live Virus, Live Fowl Pox Vector Vaccine (USDA: 10S1.R0)
- Avian Encephalomyelitis-Fowl Pox-Mycoplasma Gallisepticum Live Fowl Pox Vector, Live Virus Vaccine (USDA: )
- Avian Influenza-Fowl Pox H5 Subtype, Live Fowl Pox Vector Vaccine (USDA: 1061.R0)
- Fowl Pox Live Virus Vaccine (USDA: 1621.00)
- Fowl Pox Live Virus Vaccine (USDA: 1621.10)
- Fowl Pox Live Virus Vaccine (USDA: 1621.11)
- Fowl Pox Live Virus Vaccine (USDA: 1621.13)
- Fowl Pox Live Virus Vaccine (USDA: 1621.14)
- Fowl Pox Live Virus Vaccine (USDA: 1622.00)
- Fowl Pox-Laryngotracheitis Live Fowl Pox Vector Vaccine (USDA: 1F31.R0)
- Fowl Pox-Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 15E2.00)
- Fowl Pox-Mycoplasma Gallisepticum Live Fowl Pox Vector Vaccine (USDA: 1D51.R0)
- Newcastle Disease-Fowl Pox Live Fowl Pox Vector Vaccine (USDA: 17C1.R0)
- Quail Pox Live Virus Vaccine (USDA: 18E1.10)
- References
|
I. General Information |
1. NCBI Taxonomy ID: |
10261 |
2. Disease: |
Fowlpox |
3. Introduction |
Fowlpox is a slow-spreading viral infection of chickens and turkeys characterized by proliferative lesions in the skin (cutaneous form) that progress to thick scabs and by lesions in the upper GI and respiratory tracts (diphtheritic form). It is seen worldwide. The large DNA virus (an avipoxvirus, family Poxviridae) is highly resistant and may survive for several years in dried scabs. Field and vaccine strains have only minor differences in their genomic profiles, although the strains can be differentiated to some extent by restriction endonuclease analysis, and immunoblotting. Recently, molecular analyses of vaccine and field strains of fowlpox viruses have shown some significant differences. The virus is present in large numbers in the lesions and is usually transmitted by contact through abrasions of the skin. Skin lesions (scabs) shed from the recovering birds in poultry houses can become a source of aerosol infection. Mosquitos and other biting insects may serve as mechanical vectors. Transmission within flocks is rapid when mosquitos are plentiful. Some affected birds may become carriers, and the disease may be reactivated by stress (eg, moulting) or by immunosuppression due to other infections. The disease tends to persist for extended periods in multiple-age poultry complexes (Merck Vet Manual: Fowlpox). |
4. Host Ranges and Animal Models |
Chickens, turkeys, quail, canaries, pigeons, and many other species of birds (Wiki: Fowlpox). |
5. Host Protective Immunity |
Naturally infected or vaccinated birds develop humoral as well as cell-mediated immune responses. Humoral immune responses can be measured by ELISA or virus neutralization tests (Merck Vet Manual: Fowlpox). |
II. Vaccine Related Pathogen Genes |
1. L1 |
-
Gene Name :
L1
-
Sequence Strain (Species/Organism) :
Fowlpox virus
-
NCBI Protein GI :
P15910
-
Other Database IDs :
CDD:280581
-
Taxonomy ID :
928301
-
Protein Name :
Protein L1 homolog
-
Protein pI :
8.25
-
Protein Weight :
26579.04
-
Protein Length :
346
-
Protein Note :
Virion membrane protein M25
-
Protein Sequence : Show Sequence
>sp|P15910.4|L1_FOWPN RecName: Full=Protein L1 homolog; AltName: Full=Virion membrane protein M25
MGAAASIQTTVTTINKKISEKLEQTASASATANCDINIGNIIFKKNKGCNVLVKNMCSANASAQLDAIVS
AVREVYDQLTEQQKAYAPSLLTAALNIQTNVSTITQDFETYIKQKCNSDAVINNIINVQSLEVDECSAPP
GQIMTFEFINTGTATGNCAMKSVLDVLTKSSDRVSGNQSTGNDFSKYLYIIGGIICFLILLYYAKKLFFM
STNDKVKVLLAKKPDVHWTTYIDTYFRSSPVLV
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Pacchioni et al., 2013)
|
III. Vaccine Information |
|
|
|
|
|
|
1. Avian Encephalomyelitis-Chicken Anemia Virus-Fowl Pox Live & Modified Live Virus Vaccine (USDA: 10T1.40) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002039 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
2. Avian Encephalomyelitis-Fowl Pox Live Virus Vaccine (USDA: 10M1.10 ) |
a. Manufacturer: |
Wyeth, Lohmann Animal Health International, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002033 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
3. Avian Encephalomyelitis-Fowl Pox Live Virus Vaccine (USDA: 10M1.11) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002034 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
4. Avian Encephalomyelitis-Fowl Pox Live Virus Vaccine (USDA: 10M1.13) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002035 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
5. Avian Encephalomyelitis-Fowl Pox Live Virus Vaccine (USDA: 10M1.14) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002036 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
6. Avian Encephalomyelitis-Fowl Pox Live Virus Vaccine (USDA: 10M1.40) |
a. Manufacturer: |
Biomune Company |
b. Vaccine Ontology ID: |
VO_0002037 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
7. Avian Encephalomyelitis-Fowl Pox-Laryngotracheitis Live Virus, Live Fowl Pox Vector Vaccine (USDA: 10S1.R0) |
a. Manufacturer: |
Biomune Company |
b. Vaccine Ontology ID: |
VO_0002038 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
8. Avian Encephalomyelitis-Fowl Pox-Mycoplasma Gallisepticum Live Fowl Pox Vector, Live Virus Vaccine (USDA: ) |
a. Manufacturer: |
Biomune Company |
b. Vaccine Ontology ID: |
VO_0004205 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
9. Avian Influenza-Fowl Pox H5 Subtype, Live Fowl Pox Vector Vaccine (USDA: 1061.R0) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002032 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
10. Fowl Pox Live Virus Vaccine (USDA: 1621.00) |
a. Manufacturer: |
Wyeth, Intervet Inc., Lohmann Animal Health International, Biomune Company |
b. Vaccine Ontology ID: |
VO_0001677 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
11. Fowl Pox Live Virus Vaccine (USDA: 1621.10) |
a. Manufacturer: |
Lohmann Animal Health International, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001678 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
12. Fowl Pox Live Virus Vaccine (USDA: 1621.11) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001679 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
13. Fowl Pox Live Virus Vaccine (USDA: 1621.13) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001680 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
14. Fowl Pox Live Virus Vaccine (USDA: 1621.14) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001681 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
15. Fowl Pox Live Virus Vaccine (USDA: 1622.00) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001682 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
16. Fowl Pox-Laryngotracheitis Live Fowl Pox Vector Vaccine (USDA: 1F31.R0) |
a. Manufacturer: |
Biomune Company |
b. Vaccine Ontology ID: |
VO_0002202 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
17. Fowl Pox-Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 15E2.00) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002140 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
18. Fowl Pox-Mycoplasma Gallisepticum Live Fowl Pox Vector Vaccine (USDA: 1D51.R0) |
a. Manufacturer: |
Biomune Company |
b. Vaccine Ontology ID: |
VO_0002201 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
19. Newcastle Disease-Fowl Pox Live Fowl Pox Vector Vaccine (USDA: 17C1.R0) |
a. Manufacturer: |
Merial, Inc., Biomune Company |
b. Vaccine Ontology ID: |
VO_0002181 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
20. Quail Pox Live Virus Vaccine (USDA: 18E1.10) |
a. Manufacturer: |
Biomune Company |
b. Vaccine Ontology ID: |
VO_0001534 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Birds |
|
|
|
|
|
|
|
|
IV. References |
1. Merck Vet Manual: Fowlpox: Merck Veterinary Manual- Fowlpox in Chickens and Turkeys [http://www.merckvetmanual.com/mvm/index.jsp?cfile=htm/bc/204801.htm]
2. Pacchioni et al., 2013: Pacchioni SM, Bissa M, Zanotto C, Morghen Cde G, Illiano E, Radaelli A. L1R, A27L, A33R and B5R vaccinia virus genes expressed by fowlpox recombinants as putative novel orthopoxvirus vaccines. Journal of translational medicine. 2013; 11; 95. [PubMed: 23578094].
3. Wiki: Fowlpox: Wiki: Fowlpox [http://en.wikipedia.org/wiki/index.html?curid=6441791]
|