VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Edwardsiella tarda

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Introduction
  2. Vaccine Related Pathogen Genes
    1. degP (Protective antigen)
    2. dnaK (Protective antigen)
    3. esa1 (Protective antigen)
    4. eseC (Protective antigen)
    5. eseD (Protective antigen)
    6. et18 (Protective antigen)
    7. eta21 (Protective antigen)
    8. eta6 (Protective antigen)
    9. eta81 (Protective antigen)
    10. fimA (Protective antigen)
    11. flagellar hook assembly protein FlgD (Protective antigen)
    12. flagellin FliC (Protective antigen)
    13. fliC (Protective antigen)
    14. GAPDH (Protective antigen)
    15. groEL (Protective antigen)
    16. invasin (Protective antigen)
    17. nanA (Protective antigen)
    18. ompA (Protective antigen)
    19. ompC (Protective antigen)
    20. ompX (Protective antigen)
    21. putative exoprotein-precursor (Protective antigen)
    22. putative flagellin associated protein (Protective antigen)
    23. putative surface antigen( Esa1) (Protective antigen)
    24. aroC (Virmugen)
    25. esrB (Virmugen)
    26. esrC (Virmugen)
    27. slyA (Virmugen)
  3. Vaccine Information
    1. BL21(DE3)/pUTa-E + pET28a-FT
    2. E. coli-CPPs (Edwardsiella tarda)
    3. E. tarda DNA vaccine pCE18
    4. E. tarda DNA vaccine pCE6
    5. E. tarda DNA vaccine pCEsa1
    6. Edwardsiella tarda aroC mutant vaccine
    7. Edwardsiella tarda aroC/esrC mutant vaccine
    8. Edwardsiella tarda aroC/slyA mutant vaccine
    9. Edwardsiella tarda esrB mutant vaccine
  4. References
I. General Information
1. NCBI Taxonomy ID:
636
2. Introduction
E. tarda is typically found in the normal gut flora of fish and humans, and can be an opportunistic pathogen in human, causing gastroenteritis and diarrhea. E. tarda has a high affinity for red blood cells due to specific fimbriae that it produces (Microbe Wiki: E. tarda).
1. aroC
  • Gene Name : aroC
  • Sequence Strain (Species/Organism) : Edwardsiella tarda EIB202
  • NCBI Gene ID : 8608790
  • NCBI Protein GI : 269139790
  • Locus Tag : ETAE_2445
  • Genbank Accession : CP001135
  • Protein Accession : YP_003296491
  • Taxonomy ID : 498217
  • Gene Starting Position : 2576311
  • Gene Ending Position : 2577396
  • Gene Strand (Orientation) : -
  • Protein Name : chorismate synthase
  • Protein pI : 6.99
  • Protein Weight : 36170.26
  • Protein Length : 361
  • DNA Sequence : Show Sequence
    >gi|269137358:2576311-2577396 Edwardsiella tarda EIB202 chromosome, complete genome
    TTTACCAGCGCGGTATCGTACAGGCGACATCCGCACACTGCGCACGCTGGCGCAGCAAATGATCCATCAG
    CACCAGCGCCATCATCGCCTCGGCGATCGGCACCGCCCGGATCCCCACGCAGGGATCGTGGCGGCCGCGG
    GTGACCATGGTCGTCGCCTCGCCGTCGCGGGTAATGGTCTGCCCCGGCACCATAATGCTCGACGTCGGCT
    TCAGCGCCAGACGCGCCAGCAGCGGCTGACCGCTGCTGATCCCGCCCAGAATGCCGCCGGCATGGTTGCT
    GAGAAAGCCCGTCGGGCTGATCTCGTCACGGTGCTCGCTGCCGCGCTGCCCCACCACCGCAAAGCCGTCG
    CCGATCTCGACGCCCTTCACCGCATTGATGCTCATCAGCGCATGGGCCACGTCGGCATCCAGGCGATCGA
    AGACCGGCTCGCCCAGCCCGGGGGGAACCCCGGTCGCCATCACCATCACCTCGGCGCCGATCGAGTCGCC
    GCTCTTTTTCAGATCGCGCATCAGGGCATCCAGCGCCGCCAGCTGCTGGACATCGGGACAGAAGAAGGGA
    TTCTGCTCTACCTGCGCCCAGTCATACTGACGGCAGACGATATCGCCCATCCGGCTCAGGCAGGCGCGGA
    TAACGATGCCATGCTGCTGCTGAAGGTATTTTTTCGCGATCGCCCCGGCGGCGACGCGCATCGCGGTCTC
    CCGCGCAGAGGAGCGCCCGCCGCCGCGGTAGTCGCGCAGACCATACTTCTGCTCATAGCTGTAGTCAGCG
    TGACCCGGACGAAACAGATCCTTGATGGCGCTATAGTCCTGCGAGCGCTGATCGGTGTTCTCGATCAGCA
    GTCCAATACTGGTGCCGGTGGTCACCCCCTCAAAGACACCCGACAGGATCCGCACCCGATCATCCTCTCG
    CCGCGCCGTGGTGTAGCGCGATGCGCCGGGGCGACGGCGATCGAGATCGTGCTGCAGATCCGCCTCGCTC
    AGCGCCATTCCCGGCGGAACGCCGTCCACAATGCAGCCCAGCGCCGCACCGTGTGACTCGCCGAAGGTGG
    TGACTCTGAATACCTGACCAATGCTGTTTCCCGCCA
  • Protein Sequence : Show Sequence
    >gi|269139790|ref|YP_003296491.1| chorismate synthase [Edwardsiella tarda EIB202]
    MAGNSIGQVFRVTTFGESHGAALGCIVDGVPPGMALSEADLQHDLDRRRPGASRYTTARREDDRVRILSG
    VFEGVTTGTSIGLLIENTDQRSQDYSAIKDLFRPGHADYSYEQKYGLRDYRGGGRSSARETAMRVAAGAI
    AKKYLQQQHGIVIRACLSRMGDIVCRQYDWAQVEQNPFFCPDVQQLAALDALMRDLKKSGDSIGAEVMVM
    ATGVPPGLGEPVFDRLDADVAHALMSINAVKGVEIGDGFAVVGQRGSEHRDEISPTGFLSNHAGGILGGI
    SSGQPLLARLALKPTSSIMVPGQTITRDGEATTMVTRGRHDPCVGIRAVPIAEAMMALVLMDHLLRQRAQ
    CADVACTIPRW
  • Molecule Role : Virmugen
  • Molecule Role Annotation : An aroC mutant is attenuated in zebra fish. The aroC mutant is also protective against challenge with wild type E. tarda and has a relative percent survival of 68.3% (Xiao et al., 2011).
  • Related Vaccine(s): Edwardsiella tarda aroC mutant vaccine , Edwardsiella tarda aroC/esrC mutant vaccine
2. degP
  • Gene Name : degP
  • Sequence Strain (Species/Organism) : Edwardsiella tarda
  • NCBI Protein GI : ADB84596
  • Other Database IDs : CDD:236802
    CDD:290102
    CDD:238487
  • Taxonomy ID : 636
  • Protein Name : DegP
  • Protein pI : 7.41
  • Protein Weight : 45471.82
  • Protein Length : 517
  • Protein Note : serine endoprotease; Provisional
  • Protein Sequence : Show Sequence
    >ADB84596.1 DegP [Edwardsiella tarda]
    MKKTTLVLSAVALSLGMALSPMSASAAETSSATTAQALPSLAPMLEKVMPSVVSINVEGSATVNNSRVPP
    QFQQFFGEDSPLCQPGSPFGGSPMCQGGGNAPSKERFKALGSGVIIDAGKGYVVTNNHVVANADSIKVQL
    SDGRRFDAKVIGTDPRTDIALIQLKDAKNLTAIKMADSDNLRVGDYAVAIGNPYGLGETVTSGIVSALGR
    SGLNVENYENFIQTDAAINRGNSGGALVNLNGDLIGINTAILAPDGGNIGIGFAIPSNMVKNLTGQMVEY
    GQVKRGELGIMGTELNSELAKAMKIDAQRGAFISQVLPKSAAAKAGLKAGDVIVSLNGKNISSFASFRAE
    IGTMPVGSKLALGIIRDGKPMNVEVTLEQSAQSQVASDNIFSGIEGAELSNAAGGKGVKVDNVKKGSTAA
    RIGLQKGDVILGVNQHAIANIGELRKILDAKPPVLALNIQRGDNTLYLLMQ
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Jiao et al., 2010)
3. dnaK
  • Gene Name : dnaK
  • Sequence Strain (Species/Organism) : Edwardsiella tarda
  • NCBI Protein GI : AKH90009
  • Other Database IDs : CDD:234715
  • Taxonomy ID : 636
  • Protein Name : molecular chaperone DnaK
  • Protein pI : 4.57
  • Protein Weight : 64300.33
  • Protein Length : 704
  • Protein Note : molecular chaperone DnaK; Provisional; PRK00290
  • Protein Sequence : Show Sequence
    >AKH90009.1 molecular chaperone DnaK [Edwardsiella tarda]
    MGKIIGIDLGTTNSCVAIMDGGQPRVLENAEGDRTTPSIIAYTQDGEVLVGQPAKRQAVTNPQNTLFAIK
    RLIGRRFEDAEAQRDKDIMPYKIVPADNGDAWVEVKGQKIAPPQISAEVLKKMKKTAEDFLGEPVTEAVI
    TVPAYFNDAQRQATKDAGRIAGLDVKRIINEPTAAALAYGLDKGAGNRTIAVYDLGGGTFDISIIEIDDV
    DGEKTFEVLATNGDTHLGGEDFDSRLINYLVDEFKKEQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTD
    VNLPYITADATGPKHMNIKVTRAKLESLVEDLVARSMEPLKVALKDAGLSVSDIDDVILVGGQTRMPMVQ
    KQVADFFGKEPRKDVNPDEAVAIGAAVQGGVLAGDVKDVLLLDVTPLSLGIETMGGVMTALISKNTTIPT
    KHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGIQPAPRGMPQIEVTFDIDADGILHVSAKD
    KNSGREQNITIKASSGLSEDEIKQMVRDAEANAEADRKFEELVQVRNQADQLVHGTRKLVEEAGDKLPAS
    DKSAIEDALKALEAASKGEDKAEIEAKIQALVQASAKLQELAQQQAQSGEAQADTSAKKDDDVVDAEFEE
    VKDKK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Hu et al., 2012)
4. esa1
  • Gene Name : esa1
  • Sequence Strain (Species/Organism) : Edwardsiella tarda strain TX1
  • NCBI Protein GI : 302136428
  • Other Database IDs : CDD:236834
    CDD:284624
    CDD:279448
  • Taxonomy ID : 636
  • Gene Strand (Orientation) : ?
  • Protein Name : putative surface antigen
  • Protein pI : 5.14
  • Protein Weight : 82376.08
  • Protein Length : 866
  • Protein Note : outer membrane protein assembly factor YaeT; Provisional
  • Protein Sequence : Show Sequence
    >ADK94171.1 putative surface antigen [Edwardsiella tarda]
    MAMKKLLLASLLFGSATVYGADGFVVKNIHFEGLQRVAVGAALLNMPVRVGDTVSDEDLSNTIRALYATG
    NFEDVRVLRDGNNLIVQVKERPTIASITFSGNKSVKDEMLKQNLEASGVRVGEALDRTTLSSIEKGLEDF
    YYSVGKYNATVKAVVTPLPRNRVDLKLVFTEGKSAQIQQINIVGNHAFSSAELLGHFQLRDDVPWWNLMA
    DRKYQKQKLAGDLEALRSYYLDRGYARFAINSTQVSLTPDKKGIYITINITESEQYKLEGVDVTGNMAGY
    SAEITRLTKVEPGELYNGAKVTKMEDEIKQLLGRYGYAYPCVQTQPEINDKDKTVVLHMNIDAGNRYYVR
    QIRFVGNDTSKDAVLRREMRQMEGSWLGSDQVEQGKERLNRTGYFENVDVETQRVPGTPDQVDVIYKVKE
    RNTGSFNFGIGYGTESGVSFQVGVQQDNWLGTGNVVAINGTKNDYQTYAELSLTDPYFTVNGVSLGGRLF
    YNDFKANDADLSDYTNSSYGFDGTLGFPINENNSLRTGLGYVHNDLSDMQPQVAMWRYLRSVGQNPSDSQ
    RASYKADDYTWTAGWAYNNLDRGFFPTAGSKASLNGKITLPGSDNEYYKLTFDSQSYFPINQDRTWVVLG
    RTRLGYGNGFGGKEMPFYENFYAGGSGTVRGFQSNNIGPKAVYLNGDGSVDQSKTGDNDAVGGNAMAVAS
    LELITPTPFVSEQYANSLRTSVFMDAGTVWDTNWDQAAYPTLPDYSKATNVRLSAGIALQWMSPLGPLVF
    SYAQPVKKYEGDKAEQFQFNIGKTW
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): E. tarda DNA vaccine pCEsa1
5. eseC
  • Gene Name : eseC
  • Sequence Strain (Species/Organism) : Edwardsiella tarda EIB201
  • NCBI Protein GI : AAV69404
  • Other Database IDs : CDD:237952
  • Taxonomy ID : 636
  • Protein Name : EseC
  • Protein pI : 6.15
  • Protein Weight : 50243.03
  • Protein Length : 553
  • Protein Note : pathogenicity island 2 effector protein SseC; Provisional
  • Protein Sequence : Show Sequence
    >AAV69404.1 EseC [Edwardsiella tarda]
    MVRRQAAVPGDQGGNTASVHTGDRGDTAMNNITETRYTTPPLGGSGQNDSVQSQHDHPQIGAGALDPLRP
    PPQRQQDHDPKREFHRPPAPRQPVTLRLAEGALNRILDIFGPRVDGKPLTVSDIERTPMEAMTLAASLLG
    VKALGDNANLKALAMEIRTHGAENLRLRQNEDLRKQVEKSIEDQAKAQKAGIFSAIVDWIVSIAEVVSGI
    GKILIGDFAGGAMDVAAGCAGLVKAACETLALIDKDNAEKYQSIADVAGKVQLAFEIAGMAVDLVSVGRG
    VMASKSIAKATETVMEGAAGEALHTAVTQGSETAIKTAASEIGKQVAEQVADQVTRTLAEQSGRFLGQGH
    LLEAFSKQAIEQMVTRAVEAAAKKALQSGVEMSAKELSKQVVKEVQREVIKAIVGACIDSVANNAKSTTR
    STLQGVNSVYQGVITKERADLQKVIQQLINETDFMQFMLEEFEKIKKRAKEDIGSLMDGAGKALSAAADA
    QQKSGAMLSNIAANIA
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Song et al., 2013)
6. eseD
  • Gene Name : eseD
  • Sequence Strain (Species/Organism) : Edwardsiella tarda
  • NCBI Protein GI : AAV69405
  • Other Database IDs : CDD:185259
  • Taxonomy ID : 636
  • Protein Name : EseD
  • Protein pI : 4.77
  • Protein Weight : 20636.43
  • Protein Length : 235
  • Protein Note : pathogenicity island 2 effector protein SseD; Provisional
  • Protein Sequence : Show Sequence
    >AAV69405.1 EseD [Edwardsiella tarda]
    MTTIDSGSHGVNGITPPDGHRYVSQDRGGDAIGQLNELMVQLGELFGKLRDVLRQYQQTQQSNAFKMQKT
    AYDTRVDAIDKDFQAKQAQAIAQILGGIAQTFGGAFGEEAHTISNGVNSMTQGIVGVGYVNDMSRQSQEE
    QALSEYQHGLAEQQLKRADETLEKALKISGDLREILTTLNQAHERIASSVRMS
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Wang et al., 2010)
7. esrB
  • Gene Name : esrB
  • Sequence Strain (Species/Organism) : Edwardsiella tarda EIB202
  • NCBI Gene ID : 8607237
  • NCBI Protein GI : 269138242
  • Locus Tag : ETAE_0886
  • Genbank Accession : CP001135
  • Protein Accession : YP_003294942
  • Taxonomy ID : 498217
  • Gene Starting Position : 964657
  • Gene Ending Position : 965301
  • Gene Strand (Orientation) : -
  • Protein Name : two-component response regulator EsrB, LuxR family
  • Protein pI : 9.13
  • Protein Weight : 21902.65
  • Protein Length : 214
  • DNA Sequence : Show Sequence
    >gi|269137358:964657-965301 Edwardsiella tarda EIB202 chromosome, complete genome
    ATTAAAACTCCAGAACCCCCAGGCGGCGGGCCCAGTTGCTCAGCTCCGCCGCGTTGTGGGCATCCAGCTT
    GCGCATCAGGTTGAGCCGGTGGGTCTCCACGGTTTTCAGGCTGATGGACAGCAGCTCCGCGATATCCCGG
    TTGCGCTTGCCCTCGGCGACCAGCTTGAGAATTTGCCGTTCGCGCAGGGTCAGCGGCGGCTCCTGAGCCA
    TATCGGACGAGGCTACCAGGGAGTCCAGCCGGAGGGCGGGATCGACAAAGGTTTTCCCCAGCGAGGCATG
    CTGCATGGCCGCCAGCAGGGTTTGCTGCGGGCTTTGCTTCAGGACGTAGGCGAGCGCGCCGGCGGCGAGG
    GCTTCGCTGCCGCGCCGTGCCTCAGAGGAGGCGGTGACGACGACGATACGCATATCGCTCCAGCGACGCC
    GCAGCTGACGGATCACGTCAACGCCGTCCATGCCCGGCAGACCCAGATCGAGTAAGACCAGATCGGGCGA
    GAGACGCTGGCAGGCCTCATAAACGGCCAGCCCATTCGAGACGGCGCCCACGACCCGGTAGCGGGGCTGG
    CTGTCCAAGAGATTACGGATGCCATCGGCTAGCAAGGCATGATCTTCAACGATCAGAATGTTCAGAGGCA
    AAATAGAAATAGTCA
  • Protein Sequence : Show Sequence
    >gi|269138242|ref|YP_003294942.1| two-component response regulator EsrB, LuxR family [Edwardsiella tarda EIB202]
    MTISILPLNILIVEDHALLADGIRNLLDSQPRYRVVGAVSNGLAVYEACQRLSPDLVLLDLGLPGMDGVD
    VIRQLRRRWSDMRIVVVTASSEARRGSEALAAGALAYVLKQSPQQTLLAAMQHASLGKTFVDPALRLDSL
    VASSDMAQEPPLTLRERQILKLVAEGKRNRDIAELLSISLKTVETHRLNLMRKLDAHNAAELSNWARRLG
    VLEF
  • Molecule Role : Virmugen
  • Molecule Role Annotation : An esrB mutant is highly attenuated in fish (turbot), with an LD50 of 10(8.1)cfu/fish. Vaccination with this mutant elicited significant protection from wild type E. tarda (Lan et al., 2007).
  • Related Vaccine(s): Edwardsiella tarda esrB mutant vaccine
8. esrC
  • Gene Name : esrC
  • Sequence Strain (Species/Organism) : Edwardsiella tarda EIB202
  • NCBI Gene ID : 8607212
  • NCBI Protein GI : 269138217
  • Locus Tag : ETAE_0861
  • Genbank Accession : CP001135
  • Protein Accession : YP_003294917
  • Taxonomy ID : 498217
  • Gene Starting Position : 942933
  • Gene Ending Position : 943625
  • Gene Strand (Orientation) : -
  • Protein Name : putative transcriptional regulator EsrC
  • Protein pI : 9.57
  • Protein Weight : 25155.32
  • Protein Length : 230
  • DNA Sequence : Show Sequence
    >gi|269137358:942933-943625 Edwardsiella tarda EIB202 chromosome, complete genome
    TTTAGCCGGCGCGGTGGTGAAGGCTGGCCCGACGCACTTCGCTCGGTGACTGACTAAAGTGACGCCGAAA
    GCAGTCAGAGAAGTGGGCGGCGTTACAGAATCCGGACTCCAGCGCGACGTCGATCACCTTTTTAGAGGTG
    GTTTCGAGTAGCTGGCGGGCATGGCCCAGACGCTGGCGCAGTAGCCAGCGTTTCGGCGCCATGCCGAACT
    TGTCGTTGAACAGCTGGTTGAACTTACGCTGCGACAGGCCGAAGAGATCGGCGTAGCGCGCGACCGGCCA
    GGGTTCGAGCCGATGGCGGTAGAGCGTGTCGAACAGGTCGGCATCGGCGGTTAACAGCGATCGCAGCAGG
    GTGGAGGTCCGTTGACACTCCAGGGTCAGGCTGTAGGCCAAGACCAGCCTGAGCATGGTTTCATCGTCGG
    CATCCGCGAGCCGCAGCAGCGTTTTCAGCAGGCCCGGCGCCATGGCGATGGGGAGCGGCTGAGGGGGCGC
    GACGGGGGCCGGGCCGCTGTACATCAGGTGCTGCAAATCGCGGCATATGCCGTGCAGCAGATTACACGGA
    TAGCTAAATAGCCGAGTATGCCGGGTCGACGCGATGCCGGGAGGACGCGAGTCAGCGATCAGCAGCGCGC
    CGGGCTCCGGCAGGAGCGCGATGTTGTCTGGACCGGTGACGAGCAGTAGATGCAAATTGGGCA
  • Protein Sequence : Show Sequence
    >gi|269138217|ref|YP_003294917.1| putative transcriptional regulator EsrC [Edwardsiella tarda EIB202]
    MPNLHLLLVTGPDNIALLPEPGALLIADSRPPGIASTRHTRLFSYPCNLLHGICRDLQHLMYSGPAPVAP
    PQPLPIAMAPGLLKTLLRLADADDETMLRLVLAYSLTLECQRTSTLLRSLLTADADLFDTLYRHRLEPWP
    VARYADLFGLSQRKFNQLFNDKFGMAPKRWLLRQRLGHARQLLETTSKKVIDVALESGFCNAAHFSDCFR
    RHFSQSPSEVRRASLHHRAG
  • Molecule Role : Virmugen
  • Molecule Role Annotation : An aroC and esrC mutant is attenuated in zebra fish. This mutant is also protective against challenge with wild type E. tarda and has a relative percent survival of 71.3% (Xiao et al., 2011).
  • Related Vaccine(s): Edwardsiella tarda aroC/esrC mutant vaccine
9. et18
  • Gene Name : et18
  • Sequence Strain (Species/Organism) : Edwardsiella tarda
  • NCBI Protein GI : 74474893
  • Other Database IDs : CDD:182907
  • Taxonomy ID : 636
  • Gene Strand (Orientation) : ?
  • Protein Name : antigenic protein Et 18
  • Protein pI : 9.61
  • Protein Weight : 18746.93
  • Protein Length : 257
  • Protein Note : outer membrane lipoprotein; Provisional
  • Protein Sequence : Show Sequence
    >BAE44431.1 antigenic protein Et 18 [Edwardsiella tarda]
    MTMRFPLTRCFPALVVLSALLLQGCVAAVIGSATMATQAASDPRSVGTQVDDGTLEARISNALSKDAQLK
    KEARVVVTAYQGQVLLTGQAPSQALISRAKQIAMGVEGTKAVYNEIRLGQPVSLGTASADAWITTKVRSQ
    LLASDQVKSTNVKVTTENGEVFLLGLVTPKEGQAAAQTASKVSGVKHVTTAFSLLK
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): E. tarda DNA vaccine pCE18
10. eta21
  • Gene Name : eta21
  • Sequence Strain (Species/Organism) : Edwardsiella tarda
  • NCBI Protein GI : ACY64541
  • Other Database IDs : CDD:223685
  • Taxonomy ID : 636
  • Protein Name : putative peptidase
  • Protein pI : 5.08
  • Protein Weight : 53867.86
  • Protein Length : 571
  • Protein Note : Predicted Zn-dependent peptidase [General function prediction only]; COG0612
  • Protein Sequence : Show Sequence
    >ACY64541.1 putative peptidase [Edwardsiella tarda]
    MQYTKLRLMVGGLALAMVGTSVHSETLQPDPAWQEGKLPNGFSWQILATPQRPSDRIELRMIVNTGSLSE
    SPQQVGYAHLLPRLALAQGKGLDATALQSFWQQAIDPVRPMPAAITSYDYTSYNLSLPNNRPDLMKDALR
    WLANTAGDLQVNAETVGEALKGSDSRVMALPGEAGDPWWRYRLKGSNLLGHEPGRTAAVPLAPAQLKAFY
    HQWYTPDAITLYVVGNVDARALSEQINQTFGPLSGKRETPATVPALPALAAAPVSLIADGAKQDILSLVW
    DTPWQPIRDSQMLLRYWRSDLAREALFWHLQQVLANSALKGSVNLSFNCQVQYQRSQCAIHLETAQASLS
    KTLAFIADEMSALRDDGITQPEFDTLLGQKNDQLSHLFATYARTNTDILMSQRLRSQQSGVVDIAPEAYQ
    KLRQTFLSALTLDDINQELHIMLSREPAVVLRQPRGEAEENVGRLLEEYNRVMGLGGEEAVAAEAVDPPS
    PPTAAENPAHETTPPQPLAQ
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Jiao et al., 2009)
11. eta6
  • Gene Name : eta6
  • Sequence Strain (Species/Organism) : Edwardsiella tarda strain TX1
  • NCBI Protein GI : 262223754
  • Other Database IDs : CDD:320798
    CDD:153074
  • Taxonomy ID : 636
  • Gene Strand (Orientation) : ?
  • Protein Name : hypothetical protein Eta6
  • Protein pI : 8.03
  • Protein Weight : 17712.21
  • Protein Length : 230
  • Protein Note : Protease Inhibitor Ecotin; homodimeric protease inhibitor; cl00178
  • Protein Sequence : Show Sequence
    >ACY38270.1 hypothetical protein Eta6 [Edwardsiella tarda]
    MKTFSMMMAGMMLAASSVSAWAGSADLSRQPLDKVAPYPQAEQGMTRQVIYLPPRDDEAALRVELLIGKT
    LQVDCNRQRLMGQLESKTLQGWGYDYLVMDKVSGPMGTLMACPDNQRHPAFVTVHLGDSALQRYNSKLPL
    VVYVPQGVQVKYRIWQAQPAVMDAQIK
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): E. tarda DNA vaccine pCE6
12. eta81
  • Gene Name : eta81
  • Sequence Strain (Species/Organism) : Edwardsiella tarda
  • NCBI Protein GI : AFM47374
  • Taxonomy ID : 636
  • Protein Name : putative adhesin
  • Protein pI : 4.5
  • Protein Weight : 23166.97
  • Protein Length : 281
  • Protein Sequence : Show Sequence
    >AFM47374.1 putative adhesin [Edwardsiella tarda]
    MENNLLGDGFKLPKGLTDYGAAAQSWNQYAEKNGLTPEQKQAGLDRLAKGDLPEDTNITKAIVEGYQDGV
    MIAETWYLGPAASVRKVIGGGIIAEIANGSYQWFDLSQPGNGNKSWDWKSSTSAGITGILAPRRSIGQNV
    GIAMGSAFFTDGPDTGSIGGAAAGAWAGGLFGEYASGIVNSLTSKKVPGFIFNTTGSFSSEILGGYIKDA
    VNGTQLSSERNKEVGE
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Sun et al., 2012)
13. fimA
  • Gene Name : fimA
  • Sequence Strain (Species/Organism) : Edwardsiella tarda
  • NCBI Protein GI : ABK57121
  • Other Database IDs : CDD:226069
  • Taxonomy ID : 636
  • Protein Name : major fimbrial subunit protein
  • Protein pI : 7.41
  • Protein Weight : 17441.13
  • Protein Length : 245
  • Protein Note : Pilin (type 1 fimbria component protein) [Cell motility]; COG3539
  • Protein Sequence : Show Sequence
    >ABK57121.1 major fimbrial subunit protein [Edwardsiella tarda]
    MKKILLPVMALSASVMSGQVSAANGTVNFTGEIINSTCQVSGDSKNIDVYLGKYPTSAFKAIGDKSASKA
    FQINLEQCEPGTYTVRFDGNTVAGHPDLLAVSGDGSTAAAQGLGIEITDINGKHFAIANKATGEEPTVKV
    VGDKKAVFNLQARYRSYADTVTAGLANATSPFTIEYK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Wang et al., 2013)
14. flagellar hook assembly protein FlgD
  • Gene Name : flagellar hook assembly protein FlgD
  • Sequence Strain (Species/Organism) : Edwardsiella tarda
  • NCBI Protein GI : WP_035598485
  • Other Database IDs : CDD:235847
  • Taxonomy ID : 636
  • Gene Strand (Orientation) : ?
  • Protein Name : flagellar hook assembly protein FlgD
  • Protein pI : 4.31
  • Protein Weight : 22480.86
  • Protein Length : 311
  • Protein Note : flagellar basal body rod modification protein; Reviewed; PRK06655
  • Protein Sequence : Show Sequence
    >WP_035598485.1 flagellar hook assembly protein FlgD [Edwardsiella tarda]
    MAISVSLNDPVNTGSSVNASSKNGLVADNSQDLQNNFLTLLVAQLRNQDPTNPLQNNELTTQLAQISTVS
    GIEKLNTTLGSISSQINSNQSLQASSLIGHGVMIPGKTILTGKGEGEGKVSTTPFGFELESGAQSVVVTI
    TDNTGKVVKQIDMGSHNAGVFSYTWDGKGEDGVEVPDGAYNFSVSASNQGQQVVVQPLHFAMVNGVTQSS
    KGALLELGLAGTATLADVRQIL
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Beck et al., 2017)
15. flagellin FliC
  • Gene Name : flagellin FliC
  • Sequence Strain (Species/Organism) : Edwardsiella tarda
  • NCBI Protein GI : ATI65365
  • Other Database IDs : CDD:235867
  • Taxonomy ID : 636
  • Protein Name : flagellin FliC
  • Protein pI : 4.68
  • Protein Weight : 42166.51
  • Protein Length : 479
  • Protein Note : flagellin; Validated
  • Protein Sequence : Show Sequence
    >ATI65365.1 flagellin FliC [Edwardsiella tarda]
    MAQVINTNSLSLMAQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAISNRFTANINGLTQASRNAND
    GISLAQTTEGALNEVNDNLQNIRRLTVQAQNGSNSSSDLQSIQDEINQRLSEIDRISQQTDFNGVKVLSS
    DQKLTIQVGANDGETIDIDLKNINKDTLGLTSFSVAKGIDGTKATTALKAATNVDTGVSVDLAKTQTAKA
    DSKTITGFVSTDDGAVYAINGDADKFFKVETVSKDGQVTVSATAAAGDELTAAKAGSTATKANITVAGSA
    VTGADKGNLYEYTGTEKGHPQVVIKDGDKFYSASFDKDGKVTRGNELASVLKSEDPLATLDKALSQVDDL
    RSGLGAVQNRFDSVINNLNSTVNNLSASRSRIQDADYATEVSNMSRAQILQQAGTSVLAQANQSTQNVLS
    LLR
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Jiao et al., 2010)
16. fliC
  • Gene Name : fliC
  • Sequence Strain (Species/Organism) : Edwardsiella tarda strain TX1
  • NCBI Protein GI : 262223752
  • Other Database IDs : CDD:235867
    CDD:279061
    CDD:279090
  • Taxonomy ID : 636
  • Gene Strand (Orientation) : ?
  • Protein Name : flagellin
  • Protein pI : 4.71
  • Protein Weight : 41122.32
  • Protein Length : 467
  • Protein Note : flagellin; Validated
  • Protein Sequence : Show Sequence
    >ACY38269.1 flagellin [Edwardsiella tarda]
    MAQVINTNSLSLMAQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAISNRFTANINGLTQASRNAND
    GISLAQATEGALNEVNDNLQNIRRLTVQAQNGSNSSSDLQSIQDEITQRLSEIDRISQQTDFNGVKVLSK
    DQKLTIQVGANDGETIDIDLKNINAQSLGLDKFNVADSVDTTKVAAAAATKVNGPMVNIDTNGKDAGGKA
    ITGYVKDDKGDVYGAYDDAGTTKYAKATIGDDGKVTAFDTASATPSGTTNAVSQVTSKVAPKGADAANVY
    AYTGTEKGASAYVIKEGTGADAKYFKASVAEDGTVTKGSALSTTAKTADPLATLDKALSQVDDLRSGLGA
    VQNRFDSVINNLNSTVNNLSASRSRIQDADYATEVSNMSRAQILQQAGTSVLAQANQSTQNVLSLLR
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): E. tarda DNA vaccine pCE18 , E. tarda DNA vaccine pCE6
17. GAPDH
  • Gene Name : GAPDH
  • Sequence Strain (Species/Organism) : Edwardsiella tarda
  • NCBI Protein GI : AGO59148
  • Other Database IDs : CDD:185323
    CDD:278473
    CDD:280894
  • Taxonomy ID : 636
  • Protein Name : glyceraldehyde-3-phosphate dehydrogenase
  • Protein pI : 6.52
  • Protein Weight : 32379.9
  • Protein Length : 411
  • Protein Note : glyceraldehyde-3-phosphate dehydrogenase A; Provisional; PRK15425
  • Protein Sequence : Show Sequence
    >AGO59148.1 glyceraldehyde-3-phosphate dehydrogenase [Edwardsiella tarda]
    MTIKVGINGFGRIGRIVFRAAQERCDIEIVGINDLLDANYMAYMLKYDSTHGRFNGTVEVKDGHLIVNGK
    KIRVTAERDPANLKWDEIGVDVVAEATGLFLTDETARKHIAAGAKKVVMTGPSKDATPMFVMGVNHKNYA
    GQEIVSNASCTTNCLAPLAKVLNDNFGIVEALMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTG
    AAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTARLAKPATYQQICDVMKAASEGEMKGVLGYTDEAVV
    STDFNGEVCTSVFDADAGISLNDNFVKLVSWYDNETGYSNKVLDLIAHISK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Trung et al., 2014)
18. groEL
  • Gene Name : groEL
  • Sequence Strain (Species/Organism) : Edwardsiella tarda
  • NCBI Protein GI : AGN29187
  • Other Database IDs : CDD:295468
  • Taxonomy ID : 636
  • Protein Name : GroEL
  • Protein pI : 4.4
  • Protein Weight : 35715.74
  • Protein Length : 421
  • Protein Note : chaperonin_like superfamily. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings, each composed of 7-9 subunits. There are 2 main chaperonin groups. The symmetry of type I...; cl02777
  • Protein Sequence : Show Sequence
    >AGN29187.1 GroEL, partial [Edwardsiella tarda]
    VLDKSFGSPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVA
    AGMNPMDLKRGIDKAVIAAVEELKALSVPCSDSKAIAQVGTISANADDTVGQLIAEAMEKVGKEGVITVE
    EGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLL
    IIAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIATLTAGTVISEEIGMELEKATLEDLG
    QAKRVVINKDTTTIIDGVGEESAIQGRVTQIRQQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVE
    MKEKKARVEDALHATR
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Liu et al., 2016)
19. invasin
  • Gene Name : invasin
  • Sequence Strain (Species/Organism) : Edwardsiella tarda
  • NCBI Protein GI : AKH88306
  • Other Database IDs : CDD:288753
    CDD:214751
  • Taxonomy ID : 636
  • Protein Name : invasin
  • Protein pI : 6.4
  • Protein Weight : 73137.11
  • Protein Length : 746
  • Protein Note : Invasin beta-domain of outer membrane; pfam11924
  • Protein Sequence : Show Sequence
    >AKH88306.1 invasin [Edwardsiella tarda]
    MLTWVNVICQILSPISMTFTPVIVARAEVPPRPVYTSTQPYILRNDDSIASIAAKFNTTPAQLEKLNQFR
    HFAHGFMQVGPGDEIDVPNPAMEKRRQHDEESAAQRSRVDSSRRETWLQPPAPLMQAGMALASSHPSEAT
    TSLARTLATSAANEEIQTWLKQYGTARVQLNVDKNFSLQESALDWLLPLSDTPNLTLFTQLGARNKDHRH
    TMNIGVGARTLFGNWLFGLNTFYDRDLTGHNSRIGMGAEAWTDYLQLSANSYFRLGSWHQSHDFADYDER
    AANGFDLRANGWLPALPQLGAKLVYEQYQGEHVALFGKDNLQRNPSALTAGINYTPFPLLTIGIDERLGK
    EGHNDTQFNIQLNYHPGAEWQSQIDPGAVAATRRIDEARYNLVERNNNIVLEYKKQDLIHLALSSHAIRA
    WPGSVHTLSAILQSKYGIEQISWQDGGLAAAGGQLIALDKTHFRLTLPPYKVARARNAAPTPTAEEIAAN
    TYHLTAIAFDSQGNPSNSETLVVTVQPLQAVLRSAPIVTGDYALANGRDQIGVDFIVQDSQGNPLVDREV
    ILHTNNGAQPTTLTVKTDSRGIAHIAVTNTNAGITRVTAEIDGQTQYQDITFVHPDISITISGLVKGYPL
    VGETLSAQVSCGTAGCPNALRYQWQIEDAINSGRYSDIPGANATTYTPIGSDQKRRIQVIVNPE
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Li et al., 2012)
20. nanA
  • Gene Name : nanA
  • Sequence Strain (Species/Organism) : Edwardsiella tarda
  • NCBI Protein GI : AFP73415
  • Other Database IDs : CDD:271234
    CDD:214872
  • Taxonomy ID : 636
  • Protein Name : NanA
  • Protein pI : 5.17
  • Protein Weight : 71114.69
  • Protein Length : 719
  • Protein Note : Non-viral sialidases; cd15482
  • Protein Sequence : Show Sequence
    >AFP73415.1 NanA [Edwardsiella tarda]
    MLIFAEHDRTANNGWRIPAITVTQGGALIAVSDARAVGTSDIGQNQDVHFGYRISYDRGDTWGEIHDIAP
    SFNGKRQISDPAIVYNPDSGSTFLFGYYNDRFITSKPLSRVSDFFMFTSDDGGKTWDRGTSLYDLAPTGY
    KYILQGPGSGMYHDGTLYLAAQAWHHDRDSSLVGSGATVTSGYLYSSDNGVTWNSAWLRPDDKIVGAPGT
    GVDDLPDITSESSVFHHDGHIYLAAKSETSRESKSRVVYRTKDNGQRWERVEEAFLPENISRAETSSLSL
    DDSVYLVGYSTATERANRDGIYITTNTGRTIQVYDSPSYGYTSMTKDEDNLYILFEGEGDIYLQRYDIAA
    RDYANISATILNRSNDLFDIATKLRTASSYIKGGYGSHASSDAEFVYADDWGKLGVFFARQSENSQRVPG
    TIQYTNSDVSLTLAKDDILFSGDNVFVGYQHSDIQYDNDAANKVKSVLAGYSYQHDFGVLSYHLMVNTIY
    GENRFSRNRREGLGRKADFNAYSVAIKNMLAKDIYLADGFYAGVASGLHSTFFSHSAIQERGGNGWNNAS
    VDSADHASNQLLLDGQLSKRLHIMQSNELTLTAKASYQYELMDTAKWAEAYRVLDARRLMPAPVKRYPHG
    LATGYLEAALSLHPQAVIAAGASLNTDGDGLVAGSFTYTF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Jin et al., 2012)
21. ompA
  • Gene Name : ompA
  • Sequence Strain (Species/Organism) : Edwardsiella tarda
  • NCBI Protein GI : ACT33424
  • Other Database IDs : CDD:236764
    CDD:279698
    CDD:143586
  • Taxonomy ID : 636
  • Protein Name : outer membrane protein A precursor
  • Protein pI : 7.48
  • Protein Weight : 35556.31
  • Protein Length : 426
  • Protein Note : outer membrane protein A; Reviewed
  • Protein Sequence : Show Sequence
    >ACT33424.1 outer membrane protein A precursor [Edwardsiella tarda]
    MKKTAIALAVALAGFATVAQAAPKDDTWYVGGKLGWSHFISNSFEDMGTTKSHPNQLGAGAFFGYQANPY
    LGFEMGYDWLGRMGYTGDVNAKFKSQGVQLAAKLSYPLMDDLDVYTRLGGMVWRSDIHGAADGGDYTSSH
    DTGVSPLAAIGVEYALNKDWATRLDYQYVNKVGTRSETGARPDNTMLSLGVVYRFGQDEVAAPAPIPAPA
    PAPVVETKRFTLKSDVLFNFNKYTLKAEGRQALDQLYSQLSSMDPKDGSVVVLGYTDRIGSDQYNLKLSK
    QRAQTVVDYLVSKGIPADKIAARGMGKADPVTGSTCDNVKPRAALINCLAPDRRVVIEVKGIKEEVTQPQ
    A
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Beck et al., 2017)
22. ompC
  • Gene Name : ompC
  • Sequence Strain (Species/Organism) : Edwardsiella tarda
  • NCBI Protein GI : ADM43235
  • Other Database IDs : CDD:328747
    CDD:238208
  • Taxonomy ID : 718251
  • Protein Name : Outer membrane protein C precursor Porin OmpC
  • Protein pI : 8.23
  • Protein Weight : 40772.04
  • Protein Length : 470
  • Protein Note : Porin superfamily. These outer membrane channels share a beta-barrel structure that differ in strand and shear number. Classical (gram-negative) porins are non-specific channels for small hydrophillic molecules and form 16 beta-stranded barrels (16,20)...; cl21487
  • Protein Sequence : Show Sequence
    >ADM43235.1 Outer membrane protein C precursor Porin OmpC [Edwardsiella tarda FL6-60]
    MMNKIRSLVALSTIGCIGIFPLISHAAEIYNQNGNRVYLDGSFKVRHYFSQDKYIAGDQSKVKFTLRGET
    KINDLMIGYARWEYNVKLNQPESAGSTKNTTRIGYAGVGFGQYGSFDYGRNYGILNDINGWTGAPIPVFG
    GVSYDGVDNFMTYRTNNVATYRNRNIFNLVDGLDFGLQVQGKNDGWNDPENQTGPLSSNPRGVAHQNGNG
    VGTSLVYRFENGLSVGGAYANSARTLEQRQDDLGKRADGWNVGARYDNHNVYLAAIYGEVKNMHYIGKQD
    GFAPKARGYELLAQYQFDCGLKPSIAYLNGTAKDLKGNAGSNQTYVKFIDLATTYSFNKNLALIFEYKIN
    LLDDNTFTRNNGISTDDVFVTMLNYKF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Liu et al., 2017)
23. ompX
  • Gene Name : ompX
  • Sequence Strain (Species/Organism) : Edwardsiella tarda ATCC 15947
  • NCBI Protein GI : GAC64620
  • Taxonomy ID : 667121
  • Protein Name : outer membrane protein X
  • Protein pI : 8.81
  • Protein Weight : 20276.732
  • Protein Length : 277
  • Protein Note : contig: ET112;
    type strain of Edwardsiella tarda
  • Protein Sequence : Show Sequence
    >GAC64620.1 outer membrane protein X [Edwardsiella tarda ATCC 15947 = NBRC 105688]
    MKTRWRALSLLITMGITAPAMADAQTVSLGYAQAKVADFKNIAGVNLKYRYEWDSPLSLMTSFTYMSGSK
    SFEDKAGLDYSRGNGDVKYYSLAAGPAWRISDTVSVYGLVGVNVNKTTVSSTWREVSFGSYQEGSLQESR
    SKGAVMYGAGVQINPLANWSVDIGYEGSRVDLGGSKHSINGFNLGVGYRF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Liu et al., 2017)
24. putative exoprotein-precursor
  • Gene Name : putative exoprotein-precursor
  • Sequence Strain (Species/Organism) : Edwardsiella tarda EIB202
  • NCBI Protein GI : ACY84923
  • Other Database IDs : CDD:328937
  • Taxonomy ID : 498217
  • Protein Name : putative exoprotein-precursor
  • Protein pI : 4.89
  • Protein Weight : 29144.23
  • Protein Length : 349
  • Protein Note : Autotransporter beta-domain; cl22877
  • Protein Sequence : Show Sequence
    >ACY84923.1 putative exoprotein-precursor [Edwardsiella tarda EIB202]
    MGFSEVMPALITREADRQLDWVLIGFDVAPDSEREEDAASLLALNYRSFMAEVQYLDKRQLDLRNDPTDS
    GVWARVLHGAGSAAENYRDRYLHLQVGADRRYGLGETGDLFAGATATFTDGRASGDAFSSKSRALGAGLY
    ATALFPSGLFVDLNGKYVHHSTEYQVSLAGLGERKATNHAWYARADVGYRYGLSESAFVEPHLEMVYGTY
    SSTRFDWRDQGMAVSLAQPRFTPLLATAGVALGKQFTLGEWQTTLRAGVDYQRELISGGGYAAA
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Song et al., 2013)
25. putative flagellin associated protein
  • Gene Name : putative flagellin associated protein
  • Sequence Strain (Species/Organism) : Edwardsiella tarda EIB203
  • NCBI Protein GI : ACY84965
  • Other Database IDs : CDD:235867
  • Taxonomy ID : 498217
  • Protein Name : putative flagellin associated protein
  • Protein pI : 4.67
  • Protein Weight : 41788.22
  • Protein Length : 501
  • Protein Note : flagellin; Validated
  • Protein Sequence : Show Sequence
    >ACY84965.1 putative flagellin associated protein [Edwardsiella tarda EIB202]
    MAQVINTNSLSLMAQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAISNRFTANINGLTQASRNAND
    GISLAQTTEGALNEVNDNLQNIRRLTVQAQNGSNSSSDLQSIQDEITQRLSEIDRISQQTDFNGVKVLSK
    DQKLTIQVGANDGETIDIDLKNINAQSLGLDKFNVADSVDTTKVAAAAPAKVKTNIDVAINNDATLKADS
    KDITGYEQKGADLYAKNTDGKLFKVTTIDNTTGKVTGVDTTEYTGGGTTAVTSIKKEVAPTGPDAANLRA
    YSGIEKGASAYVIQEGTGADAKYFKASVADDGTVTKGSALSTTVKTADPLATLDKALSQVDDLRSGLGAV
    QNRFDSVINNLNSTVNNLSASRSRIQDADYATEVSNMSRAQILQQAGTSVLAQANQSTQNVLSLLR
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Song et al., 2013)
26. putative surface antigen( Esa1)
  • Gene Name : putative surface antigen( Esa1)
  • Sequence Strain (Species/Organism) : Edwardsiella tarda
  • NCBI Protein GI : ADK94171
  • Other Database IDs : CDD:236834
    CDD:284624
    CDD:279448
  • Taxonomy ID : 636
  • Protein Name : putative surface antigen
  • Protein pI : 5.14
  • Protein Weight : 82376.08
  • Protein Length : 866
  • Protein Note : outer membrane protein assembly factor YaeT; Provisional
  • Protein Sequence : Show Sequence
    >ADK94171.1 putative surface antigen [Edwardsiella tarda]
    MAMKKLLLASLLFGSATVYGADGFVVKNIHFEGLQRVAVGAALLNMPVRVGDTVSDEDLSNTIRALYATG
    NFEDVRVLRDGNNLIVQVKERPTIASITFSGNKSVKDEMLKQNLEASGVRVGEALDRTTLSSIEKGLEDF
    YYSVGKYNATVKAVVTPLPRNRVDLKLVFTEGKSAQIQQINIVGNHAFSSAELLGHFQLRDDVPWWNLMA
    DRKYQKQKLAGDLEALRSYYLDRGYARFAINSTQVSLTPDKKGIYITINITESEQYKLEGVDVTGNMAGY
    SAEITRLTKVEPGELYNGAKVTKMEDEIKQLLGRYGYAYPCVQTQPEINDKDKTVVLHMNIDAGNRYYVR
    QIRFVGNDTSKDAVLRREMRQMEGSWLGSDQVEQGKERLNRTGYFENVDVETQRVPGTPDQVDVIYKVKE
    RNTGSFNFGIGYGTESGVSFQVGVQQDNWLGTGNVVAINGTKNDYQTYAELSLTDPYFTVNGVSLGGRLF
    YNDFKANDADLSDYTNSSYGFDGTLGFPINENNSLRTGLGYVHNDLSDMQPQVAMWRYLRSVGQNPSDSQ
    RASYKADDYTWTAGWAYNNLDRGFFPTAGSKASLNGKITLPGSDNEYYKLTFDSQSYFPINQDRTWVVLG
    RTRLGYGNGFGGKEMPFYENFYAGGSGTVRGFQSNNIGPKAVYLNGDGSVDQSKTGDNDAVGGNAMAVAS
    LELITPTPFVSEQYANSLRTSVFMDAGTVWDTNWDQAAYPTLPDYSKATNVRLSAGIALQWMSPLGPLVF
    SYAQPVKKYEGDKAEQFQFNIGKTW
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Sun et al., 2010)
27. slyA
  • Gene Name : slyA
  • Sequence Strain (Species/Organism) : Edwardsiella tarda EIB202
  • NCBI Gene ID : 8608031
  • NCBI Protein GI : 269139033
  • Locus Tag : ETAE_1684
  • Genbank Accession : CP001135
  • Protein Accession : YP_003295734
  • Taxonomy ID : 498217
  • Gene Starting Position : 1791955
  • Gene Ending Position : 1792332
  • Gene Strand (Orientation) : +
  • Protein Name : transcriptional regulator
  • Protein pI : 6.52
  • Protein Weight : 13582.65
  • Protein Length : 125
  • DNA Sequence : Show Sequence
    >gi|269137358:1791955-1792332 Edwardsiella tarda EIB202 chromosome, complete genome
    CTTGATCGATCAGCGACTGAAGCCGCTGGAGCTGACGCAGACGCATTGGGTGACGCTGTATAACATTCAC
    CGCCTGCCGCCGGAGCAGTCACAGATTCAGCTGGCCAAGGCGATTGGCATTGAGCAGCCGTCGCTGGTGC
    GTACGCTGGATCAGCTGGAAGATAAGGGTCTGATTACTCGACATATCTGTGCTAACGATCGCCGTGCCAA
    ACGCATTAAGCTGACGGACGGTGCCGAACCCGTGATTAGGGAAGTGACCGACGTGATTTCGCTGACGCGC
    AGTGAAATCCTGGACGGTATCTCAGCGGATGAGGTCTCGCTGTTGACCAGTCTGGTCGAACGTCTGGAGC
    AGAACATTATTCATTTACAGAATAAATA
  • Protein Sequence : Show Sequence
    >gi|269139033|ref|YP_003295734.1| transcriptional regulator [Edwardsiella tarda EIB202]
    MIDQRLKPLELTQTHWVTLYNIHRLPPEQSQIQLAKAIGIEQPSLVRTLDQLEDKGLITRHICANDRRAK
    RIKLTDGAEPVIREVTDVISLTRSEILDGISADEVSLLTSLVERLEQNIIHLQNK
  • Molecule Role : Virmugen
  • Molecule Role Annotation : An aroC and slyA mutant is attenuated in zebra fish. This mutant is also protective against challenge from wild type E. tarda, resulting in a relative percent survival of 80.1% (Xiao et al., 2011).
  • Related Vaccine(s): Edwardsiella tarda aroC/slyA mutant vaccine
III. Vaccine Information
1. BL21(DE3)/pUTa-E + pET28a-FT
a. Vaccine Ontology ID:
VO_0004804
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Zebrafish
e. Preparation
Cell-penetrating peptides (CPPs) are short cationic/amphipathic peptides which facilitate cellular uptake of various molecular cargoes and therefore have great potentials in vector vaccine design. Among the tested CPPs, TAT showed an excellent capability to deliver the cargo protein EGFP into cytoplasm (Ma et al., 2014). In order to establish an efficient antigen delivery system in Escherichia coli, the EGFP-TAT synthesis circuit was combined with an in vivo inducible lysis circuit PviuA-E in E. coli to form an integrated antigen delivery system, the resultant E. coli was proved to be able to lyse upon the induction of a mimic in vivo signal and thus release intracellular EGFP-TAT intensively, which were assumed to undergo a more efficient intracellular delivery by CPP to evoke protective immune responses. Based on the established antigen delivery system, the protective antigen gene flgD from an invasive intracellular fish pathogen Edwardsiella tarda EIB202, was applied to establish an E. coli recombinant vector vaccine (Ma et al., 2014).
f. Immunization Route
Intramuscular injection (i.m.)
g. Zebrafish Response
  • Vaccine Immune Response Type: VO_0000287
  • Efficacy: BL21(DE3)/pUTa-E + pET28a-FT conferred an significantly better immune protection (RPS of 63%) than the other control strains. This result suggested fused cell-penetrating peptides (CPPs) could facilitate the internalization of antigens, released by the lysed bacteria, into the immune-related cells, such as macrophage, and in turn promote a more protective immune response in host (Ma et al., 2014).
2. E. coli-CPPs (Edwardsiella tarda)
a. Vaccine Ontology ID:
VO_0004640
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Preparation
GFP-TAT synthesis circuit was combined with an in vivo inducible lysis circuit PviuA-E in E. coli to form an integrated antigen delivery system (Ma et al., 2014).
f. Immunization Route
Intramuscular injection (i.m.)
g. Fish Response
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: Hosts were challenged with E. tarda EIB202 (Ma et al., 2014).
  • Efficacy: This E. coli vector vaccine presented superior immune protection under the challenge with E. tarda EIB202, suggesting that the novel antigen delivery system had great potential in bacterial vector vaccine applications (Ma et al., 2014).
3. E. tarda DNA vaccine pCE18
a. Vaccine Ontology ID:
VO_0004556
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Japanese flounder
e. Antigen
FliC-Et18 fusion protein from E. tarda TX1 (Jiao et al., 2009)
f. Gene Engineering of et18
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
g. Gene Engineering of fliC
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
h. Vector:
pCN3 (Jiao et al., 2009)
i. Immunization Route
Intramuscular injection (i.m.)
j. Fish Response
  • Vaccine Immune Response Type: VO_0003057
  • Efficacy: Following TX1 challenge, fish immunized with pCE18, pCN3 (plasmid), and PBS exhibited cumulative mortalities of 35%, 90%, and 95%, respectively. Hence, with pCN3 as a control, the protective efficacy of pCE18 was 61% in terms of RPS (Jiao et al., 2009).
4. E. tarda DNA vaccine pCE6
a. Vaccine Ontology ID:
VO_0004557
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Japanese flounder
e. Antigen
FliC-Eta6 fusion protein from E. tarda TX1 (Jiao et al., 2009)
f. Gene Engineering of fliC
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
g. Gene Engineering of eta6
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
h. Vector:
pCN3 (Jiao et al., 2009)
i. Immunization Route
Intramuscular injection (i.m.)
j. Fish Response
  • Vaccine Immune Response Type: VO_0003057
  • Efficacy: Upon exposure to TX1 challenge, the cumulative mortalities of the pCE6-, pCN3-, and PBS-vaccinated fish were 25%, 90%, and 95%, respectively. Therefore, compared to vaccination with pCN3, vaccination with pCE6 produced a RPS of 72%, which is significantly higher than that produced by pEta6 (Jiao et al., 2009).
5. E. tarda DNA vaccine pCEsa1
a. Vaccine Ontology ID:
VO_0004558
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Japanese flounder
e. Antigen
Esa1 from E. tarda TX1 (Sun et al., 2011)
f. Gene Engineering of esa1
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
g. Vector:
pCN3 (Sun et al., 2011)
h. Immunization Route
Intramuscular injection (i.m.)
i. Fish Response
  • Vaccine Immune Response Type: VO_0003057
  • Efficacy: The accumulated mortalities of pCEsa1-, pCN3-, and PBS-vaccinated fish were 20%, 76%, and 80%, respectively. Hence, compared to PBS-vaccinated fish, pCEsa1-vaccinated fish were significantly (P < 0.05) protected, with a RPS of 75% (Sun et al., 2011).
6. Edwardsiella tarda aroC mutant vaccine
a. Vaccine Ontology ID:
VO_0002830
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Zebra fish
e. Gene Engineering of aroC
  • Type: Gene mutation
  • Description: This aroC mutant is from Edwardsiella tarda (Xiao et al., 2011)
  • Detailed Gene Information: Click here.
f. Immunization Route
Intramuscular injection (i.m.)
g. Fish Response
  • Persistence: An aroC mutant is attenuated in zebra fish (Xiao et al., 2011).
  • Efficacy: An aroC mutant is protective in zebra fish against challenge from wild type E. tarda, resulting in a 68.3% relative percent survival (Xiao et al., 2011).
7. Edwardsiella tarda aroC/esrC mutant vaccine
a. Type:
Live, attenuated vaccine
b. Status:
Research
c. Host Species as Laboratory Animal Model:
Zebra fish
d. Gene Engineering of aroC
  • Type: Gene mutation
  • Description: This aroC/esrC mutant is from Edwardsiella tarda (Xiao et al., 2011).
  • Detailed Gene Information: Click here.
e. Gene Engineering of esrC
  • Type: Gene mutation
  • Description: This aroC/esrC mutant is from Edwardsiella tarda (Xiao et al., 2011).
  • Detailed Gene Information: Click here.
f. Immunization Route
Intramuscular injection (i.m.)
g. Fish Response
  • Persistence: This aroC/esrC mutant is attenuated in zebra fish (Xiao et al., 2011).
  • Efficacy: This aroC/esrC mutant is protective against challenge from wild type E. tarda, with a 71.3% relative percent survival (Xiao et al., 2011).
8. Edwardsiella tarda aroC/slyA mutant vaccine
a. Type:
Live, attenuated vaccine
b. Status:
Research
c. Host Species as Laboratory Animal Model:
Zebra fish
d. Gene Engineering of slyA
  • Type: Gene mutation
  • Description: An aroC and slyA mutant is attenuated in zebra fish. This mutant is also protective against challenge from wild type E. tarda, resulting in a relative percent survival of 80.1% (Xiao et al., 2011).
  • Detailed Gene Information: Click here.
e. Immunization Route
Intramuscular injection (i.m.)
f. Fish Response
  • Persistence: This aroC/slyA mutant is attenuated in zebra fish (Xiao et al., 2011).
  • Efficacy: This aroC/slyA mutant is protective in zebra fish against challenge with wild type E. tarda. The percent relative survival is 80.1% (Xiao et al., 2011).
9. Edwardsiella tarda esrB mutant vaccine
a. Vaccine Ontology ID:
VO_0002833
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Fish
e. Gene Engineering of esrB
  • Type: Gene mutation
  • Description: This esrB mutant is from Edwardsiella tarda (Lan et al., 2007).
  • Detailed Gene Information: Click here.
f. Immunization Route
Intraperitoneal injection (i.p.)
g. Fish Response
  • Persistence: A esrB mutant is attenuated in fish (Lan et al., 2007).
  • Efficacy: An esrB mutant induces significant protection in fish from challenge with wild type Edwardsiella tarda (Lan et al., 2007).
IV. References
1. Beck et al., 2017: Beck BR, Lee SH, Kim D, Park JH, Lee HK, Kwon SS, Lee KH, Lee JI, Song SK. A Lactococcus lactis BFE920 feed vaccine expressing a fusion protein composed of the OmpA and FlgD antigens from Edwardsiella tarda was significantly better at protecting olive flounder (Paralichthys olivaceus) from edwardsiellosis than single antigen vaccines. Fish & shellfish immunology. 2017; 68; 19-28. [PubMed: 28687358].
2. Hu et al., 2012: Hu YH, Dang W, Deng T, Sun L. Edwardsiella tarda DnaK: expression, activity, and the basis for the construction of a bivalent live vaccine against E. tarda and Streptococcus iniae. Fish & shellfish immunology. 2012; 32(4); 616-620. [PubMed: 22281608].
3. Jiao et al., 2009: Jiao XD, Zhang M, Hu YH, Sun L. Construction and evaluation of DNA vaccines encoding Edwardsiella tarda antigens. Vaccine. 2009; 27(38); 5195-5202. [PubMed: 19596416].
4. Jiao et al., 2009: Jiao XD, Dang W, Hu YH, Sun L. Identification and immunoprotective analysis of an in vivo-induced Edwardsiella tarda antigen. Fish & shellfish immunology. 2009; 27(5); 633-638. [PubMed: 19706328].
5. Jiao et al., 2010: Jiao XD, Zhang M, Cheng S, Sun L. Analysis of Edwardsiella tarda DegP, a serine protease and a protective immunogen. Fish & shellfish immunology. 2010; 28(4); 672-677. [PubMed: 20060910].
6. Jiao et al., 2010: Jiao XD, Hu YH, Sun L. Dissection and localization of the immunostimulating domain of Edwardsiella tarda FliC. Vaccine. 2010; 28(34); 5635-5640. [PubMed: 20580470].
7. Jin et al., 2012: Jin RP, Hu YH, Sun BG, Zhang XH, Sun L. Edwardsiella tarda sialidase: pathogenicity involvement and vaccine potential. Fish & shellfish immunology. 2012; 33(3); 514-521. [PubMed: 22705341].
8. Lan et al., 2007: Lan MZ, Peng X, Xiang MY, Xia ZY, Bo W, Jie L, Li XY, Jun ZP. Construction and characterization of a live, attenuated esrB mutant of Edwardsiella tarda and its potential as a vaccine against the haemorrhagic septicaemia in turbot, Scophthamus maximus (L.). Fish & shellfish immunology. 2007; 23(3); 521-530. [PubMed: 17478097].
9. Li et al., 2012: Li MF, Hu YH, Zheng WJ, Sun BG, Wang CL, Sun L. Inv1: an Edwardsiella tarda invasin and a protective immunogen that is required for host infection. Fish & shellfish immunology. 2012; 32(4); 586-592. [PubMed: 22289712].
10. Liu et al., 2016: Liu F, Tang X, Sheng X, Xing J, Zhan W. DNA vaccine encoding molecular chaperone GroEL of Edwardsiella tarda confers protective efficacy against edwardsiellosis. Molecular immunology. 2016; 79; 55-65. [PubMed: 27701022].
11. Liu et al., 2017: Liu F, Tang X, Sheng X, Xing J, Zhan W. Comparative study of the vaccine potential of six outer membrane proteins of Edwardsiella tarda and the immune responses of flounder (Paralichthys olivaceus) after vaccination. Veterinary immunology and immunopathology. 2017; 185; 38-47. [PubMed: 28242001].
12. Liu et al., 2017: Liu F, Tang X, Sheng X, Xing J, Zhan W. Construction and evaluation of an Edwardsiella tarda DNA vaccine encoding outer membrane protein C. Microbial pathogenesis. 2017; 104; 238-247. [PubMed: 28137507].
13. Ma et al., 2014: Ma J, Xu J, Guan L, Hu T, Liu Q, Xiao J, Zhang Y. Cell-penetrating peptides mediated protein cross-membrane delivery and its use in bacterial vector vaccine. Fish & shellfish immunology. 2014; 39(1); 8-16. [PubMed: 24746937].
14. Microbe Wiki: E. tarda: Microbe Wiki: Edwardsiella tarda [http://microbewiki.kenyon.edu/index.php/Edwardsiella_tarda]
15. Song et al., 2013: Song M, Xie J, Peng X, Li H. Identification of protective immunogens from extracellular secretome of Edwardsiella tarda. Fish & shellfish immunology. 2013; 35(6); 1932-1936. [PubMed: 24099803].
16. Sun et al., 2010: Sun Y, Liu CS, Sun L. Identification of an Edwardsiella tarda surface antigen and analysis of its immunoprotective potential as a purified recombinant subunit vaccine and a surface-anchored subunit vaccine expressed by a fish commensal strain. Vaccine. 2010; 28(40); 6603-6608. [PubMed: 20673823].
17. Sun et al., 2011: Sun Y, Liu CS, Sun L. Construction and analysis of the immune effect of an Edwardsiella tarda DNA vaccine encoding a D15-like surface antigen. Fish & shellfish immunology. 2011; 30(1); 273-279. [PubMed: 21059395].
18. Sun et al., 2012: Sun Y, Zheng WJ, Hu YH, Sun BG, Sun L. Edwardsiella tarda Eta1, an in vivo-induced antigen that is involved in host infection. Infection and immunity. 2012; 80(8); 2948-2955. [PubMed: 22585967].
19. Trung et al., 2014: Trung Cao T, Tsai MA, Yang CD, Wang PC, Kuo TY, Gabriel Chen HC, Chen SC. Vaccine efficacy of glyceraldehyde-3-phosphate dehydrogenase (GAPDH) from Edwardsiella ictaluri against E. tarda in tilapia. The Journal of general and applied microbiology. 2014; 60(6); 241-250. [PubMed: 25742975].
20. Wang et al., 2010: Wang B, Mo ZL, Xiao P, Li J, Zou YX, Hao B, Li GY. EseD, a putative T3SS translocon component of Edwardsiella tarda, contributes to virulence in fish and is a candidate for vaccine development. Marine biotechnology (New York, N.Y.). 2010; 12(6); 678-685. [PubMed: 20072793].
21. Wang et al., 2013: Wang C, Hu YH, Chi H, Sun L. The major fimbrial subunit protein of Edwardsiella tarda: vaccine potential, adjuvant effect, and involvement in host infection. Fish & shellfish immunology. 2013; 35(3); 858-865. [PubMed: 23811351].
22. Xiao et al., 2011: Xiao J, Chen T, Wang Q, Liu Q, Wang X, Lv Y, Wu H, Zhang Y. Search for live attenuated vaccine candidate against edwardsiellosis by mutating virulence-related genes of fish pathogen Edwardsiella tarda. Letters in applied microbiology. 2011; ; . [PubMed: 21777261].