|
|
Hepatitis C virus |
| Table of Contents |
- General Information
- NCBI Taxonomy ID
- Disease
- Introduction
- Vaccine Related Pathogen Genes
- Core protein
(Other)
- E1
(Protective antigen)
- E2
(Protective antigen)
- VP60
(Protective antigen)
- Vaccine Information
- References
|
| I. General Information |
| 1. NCBI Taxonomy ID: |
|
11103 |
|
2. Disease: |
| Hepatitis C |
|
3. Introduction |
Hepatitis C virus (HCV) infection is the most common chronic bloodborne infection in the United States; approximately 3.2 million persons are chronically infected. Although HCV is not efficiently transmitted sexually, persons at risk for infection through injection drug use might seek care in STD treatment facilities, HIV counseling and testing facilities, correctional facilities, drug treatment facilities, and other public health settings where STD and HIV prevention and control services are available.
Sixty to 70% of persons newly infected with HCV typically are usually asymptomatic or have a mild clinical illness. HCV RNA can be detected in blood within 1–3 weeks after exposure. The average time from exposure to antibody to HCV (anti-HCV) seroconversion is 8–9 weeks, and anti-HCV can be detected in >97% of persons by 6 months after exposure. Chronic HCV infection develops in 70%–85% of HCV-infected persons; 60%–70% of chronically infected persons have evidence of active liver disease. The majority of infected persons might not be aware of their infection because they are not clinically ill. However, infected persons serve as a source of transmission to others and are at risk for chronic liver disease or other HCV-related chronic diseases decades after infection.
HCV is most efficiently transmitted through large or repeated percutaneous exposure to infected blood (e.g., through transfusion of blood from unscreened donors or through use of injecting drugs). Although much less frequent, occupational, perinatal, and sexual exposures also can result in transmission of HCV (CDC - Hepatitis C). |
| II. Vaccine Related Pathogen Genes |
|
1. Core protein |
-
Gene Name :
Core protein
-
Sequence Strain (Species/Organism) :
Hepatitis C virus
-
NCBI Protein GI :
349623451
-
Other Database IDs :
CDD:144947
-
Taxonomy ID :
11103
-
Gene Strand (Orientation) :
?
-
Protein Name :
core
-
Protein Length :
114
-
Protein Note :
Hepatitis C virus capsid protein; pfam01543
-
Protein Sequence : Show Sequence
>gi|349623451|gb|AEQ03276.1| core [Hepatitis C virus]
MSTLPKPQRKTKRNTIRRPQDVKFPGGGQIVGGVYVLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARR
SEGRSWAQPGYPWPLYGNEGCGWAGWLLSPRGSRPSWGPNDPRR
-
Molecule Role :
Other
|
|
2. E1 |
-
Gene Name :
E1
-
Sequence Strain (Species/Organism) :
Hepatitis C virus
-
NCBI Protein GI :
AAO46051
-
Other Database IDs :
CDD:110536
CDD:110557
-
Taxonomy ID :
11103
-
Protein Name :
E1
-
Protein pI :
9.58
-
Protein Weight :
5171.61
-
Protein Length :
90
-
Protein Note :
genotype: II
-
Protein Sequence : Show Sequence
>AAO46051.1 E1, partial [Hepacivirus C]
SMVGNWAKVLIVMLLFAGVDGDTHVTGGRKLTPTHRFASLFSLGPTQK
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Zhang et al., 2017)
|
|
3. E2 |
-
Gene Name :
E2
-
Sequence Strain (Species/Organism) :
Hepatitis C virus
-
NCBI Protein GI :
AAB30986
-
Other Database IDs :
CDD:110557
-
Taxonomy ID :
11103
-
Protein Name :
E2
-
Protein pI :
7.36
-
Protein Weight :
4284.5
-
Protein Length :
82
-
Protein Note :
Hepatitis C virus non-structural protein E2/NS1; pfam01560
-
Protein Sequence : Show Sequence
>AAB30986.1 E2, partial [Hepacivirus C]
MLLFAGVDGNTYVSGGATSRTTQSLVSFLSPGPQQKIQLV
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Pierce et al., 2017)
|
|
4. VP60 |
|
| III. Vaccine Information |
| IV. References |
1. CDC - Hepatitis C: Hepatitis C Information for Health Professionals [http://www.cdc.gov/hepatitis/hcv/]
2. Guo et al., 2016: Guo H, Zhu J, Tan Y, Li C, Chen Z, Sun S, Liu G. Self-assembly of virus-like particles of rabbit hemorrhagic disease virus capsid protein expressed in Escherichia coli and their immunogenicity in rabbits. Antiviral research. 2016; 131; 85-91. [PubMed: 27118636].
3. Pierce et al., 2017: Pierce BG, Boucher EN, Piepenbrink KH, Ejemel M, Rapp CA, Thomas WD Jr, Sundberg EJ, Weng Z, Wang Y. Structure-Based Design of Hepatitis C Virus Vaccines That Elicit Neutralizing Antibody Responses to a Conserved Epitope. Journal of virology. 2017; 91(20); . [PubMed: 28794021].
4. Zhang et al., 2017: Zhang S, Sun F, Ren T, Duan Y, Gu H, Lai C, Wang Z, Zhang P, Wang X, Yang P. Immunogenicity of an influenza virus-vectored vaccine carrying the hepatitis C virus protein epitopes in mice. Antiviral research. 2017; 145; 168-174. [PubMed: 28778831].
|
|
