VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Hepatitis D virus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Introduction
    3. Host Ranges and Animal Models
  2. Vaccine Related Pathogen Genes
    1. p27 (Protective antigen)
  3. Vaccine Information
    1. Hepatitis D DNA vaccine pcDNA3p27/Ad5F35p27
  4. References
I. General Information
1. NCBI Taxonomy ID:
12475
2. Introduction
HDV is found only in people who have Hepatitis B virus. It may make symptoms of hepatitis B worse or may cause symptoms in people who carry hepatitis B virus but have never displayed symptoms (A.D.A.M. Medical Encyclopedia).
3. Host Ranges and Animal Models
Humans (A.D.A.M. Medical Encyclopedia)
1. p27
  • Gene Name : p27
  • Sequence Strain (Species/Organism) : Hepatitis delta virus
  • NCBI Protein GI : 226737605
  • Other Database IDs : CDD:110514
  • Taxonomy ID : 261991
  • Gene Strand (Orientation) : ?
  • Protein Name : Large delta antigen
  • Protein Length : 214
  • Protein Note : L-HDAg; p27
  • Protein Sequence : Show Sequence
    >gi|226737605|sp|P0C6M5.1|LHDAG_HDVU2 RecName: Full=Large delta antigen; Short=L-HDAg; AltName: Full=p27; Flags: Precursor
    MSRSESKKNRGGREEILEQWVGARKKLEELERDLRKIKKKIKKLEEENPWLGNIKGILGKKDREGEGAPP
    AKRARADQMEVDSGPRKRPFRGEFTDKERRDHRRRKALENKRKQLSSGGKSLSKEEEEELRKLTEEDERR
    ERRVAGPRVGGVNPLEGGTRGAPGGGFVPSMQGVPESPFARTGEGLDVRGNQGFPWDILFPADPPFSPQS
    CRPQ
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Hepatitis D DNA vaccine pcDNA3p27/Ad5F35p27
III. Vaccine Information
1. Hepatitis D DNA vaccine pcDNA3p27/Ad5F35p27
a. Vaccine Ontology ID:
VO_0004529
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Woodchucks
e. Gene Engineering of p27
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
f. Vector:
pcDNA3 prime, Ad5/Ad5F35-vector boost (Fiedler et al., 2013)
g. Immunization Route
Intramuscular injection (i.m.)
h. Woodchuck Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: Immunization with DNA plasmid prime administered via gene gun and Ad5/Ad5F35-vector boost expressing HDAg conferred protection from HDV in WHV/HDV co-infection in 5 out of 7 immunized animals. The two animals with the breakthrough had a shorter HDV viremia as compared to the un-vaccinated controls (Fiedler et al., 2013)
IV. References
1. A.D.A.M. Medical Encyclopedia: Delta agent (Hepatitis D) [http://www.ncbi.nlm.nih.gov/pubmedhealth/PMH0001264/]
2. Fiedler et al., 2013: Fiedler M, Kosinska A, Schumann A, Brovko O, Walker A, Lu M, Johrden L, Mayer A, Wildner O, Roggendorf M. Prime/Boost Immunization with DNA and Adenoviral Vectors Protects from Hepatitis D Virus (HDV) Infection after Simultaneous Infection with HDV and Woodchuck Hepatitis Virus. Journal of virology. 2013; ; . [PubMed: 23637419].