VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Rabbit hemorrhagic disease virus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Host Ranges and Animal Models
  2. Vaccine Related Pathogen Genes
    1. VP60 (Protective antigen)
  3. Vaccine Information
    1. ALVAC-RHDV (vCP309)
    2. RHDV DNA vaccine pcDNA-VP60
    3. rORFV-RHDV-VP60
  4. References
I. General Information
1. NCBI Taxonomy ID:
11976
2. Disease:
Rabbit hemorrhagic disease
3. Introduction
Rabbit haemorrhagic disease (RHD), also known as rabbit calicivirus disease (RCD) or viral haemorrhagic disease (VHD), is a highly infectious and often fatal disease that affects wild and domestic rabbits of the species Oryctolagus cuniculus. The infectious agent responsible for the disease is rabbit haemorrhagic disease virus (RHDV), or rabbit calicivirus (RCV), genus Lagovirus of the family Caliciviridae. The virus infects only rabbits, and has been used in some countries to control rabbit populations (Wiki: Rabbit haemorrhagic disease).
4. Host Ranges and Animal Models
Rabbits
1. VP60
  • Gene Name : VP60
  • Sequence Strain (Species/Organism) : Rabbit hemorrhagic disease virus
  • NCBI Protein GI : 515625
  • Other Database IDs : CDD:119412
    GOA:Q86119
    InterPro: IPR000317
    InterPro: IPR000605
    InterPro: IPR001205
    InterPro: IPR003593
    InterPro: IPR004004
    InterPro: IPR004005
    InterPro: IPR007094
    InterPro: IPR009003
    InterPro: IPR014759
    UniProtKB/UniProt: Q86119
  • Taxonomy ID : 11976
  • Gene Strand (Orientation) : ?
  • Protein Name : VP60
  • Protein Length : 579
  • Protein Note : Picornavirus capsid protein domain_like. Picornaviruses are non-enveloped plus-strand ssRNA animal viruses with icosahedral capsids composed of 60 copies each of 4 virus encoded proteins; alignment includes picornaviridae, like poliovirus, hepatitis A...; cd00205
  • Protein Sequence : Show Sequence
    >gi|515625|emb|CAA80883.1| VP60 [Rabbit hemorrhagic disease virus]
    MEGKARTAPQGEAAGTATTASVPGTTTDGMDPGVVATTSVVTAENSSASIATAGIGGPPQQVDQQETWRT
    NFYYNDVFTWSVADAPGSILYTVQHSPQNNPFTAVLSQMYAGWAGGMQFRFIVAGIGVFGGRLVAAVIPP
    GIEIGPGLEVRQFPHVVIDARSLEPVTITMPDLRPNMYHPTGDPGLVPTLVLSVYNNLINPFGGSTSAIQ
    VTVETRPSEDFEFVMIRAPSSKTVDSISPAGLLTTPVLTGVGNDNRWNGQIVGLQPVPGGFSTCNRHWNL
    NGSTYGWSSPRFGDIGHRRGSASYPGNNATNVLQFWYANAGSAIDNPISQVAPDGFPDMSFVPFNGPGIP
    AAGWVGFGAIWNSNSGAPNVTTVQAYELGFATGAPGNLQPTTNTSGSQTVAKSIYAVVTGTAQNPAGLFV
    MASGVISTPSANAITYTPQPDRIVTTPGTPAAAPVGKNTPIMFASVVRRTGDVNATAGSANGTQYGTGSQ
    PLPVTIGLSLNNYSSALMPGQFFVWQLTFASGFMEIGLSVDGYFYAGTGASTTLIDLTELIDVRPVGPRP
    SKSTLVFNLGGTANGFSYV
  • Molecule Role : Protective antigen
  • Related Vaccine(s): RHDV DNA vaccine pcDNA-VP60 , rORFV-RHDV-VP60
III. Vaccine Information
1. ALVAC-RHDV (vCP309)
a. Vaccine Ontology ID:
VO_0004738
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Preparation
An ALVAC (canarypox)-based recombinant virus ALVAC-RHDV (vCP309) expressing a native rabbit hemorrhagic disease virus (RHDV) capsid protein was derived and assessed for its protective efficacy in rabbits (Fischer et al., 1997).
f. Immunization Route
Intramuscular injection (i.m.)
g. Rabbit Response
  • Vaccination Protocol: Rabbits were inoculated with varying doses of vCP309 (Fischer et al., 1997).
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: Rabbits were challenged with RHDV (Fischer et al., 1997).
  • Efficacy: Protection against a lethal RHDV challenge was demonstrated in rabbits inoculated twice with either high (10(7) p.f.u.) or low (10(5) p.f.u.) doses of vCP309. However, animals in the high dose group developed significantly higher antibody response (Fischer et al., 1997).
2. RHDV DNA vaccine pcDNA-VP60
a. Vaccine Ontology ID:
VO_0004577
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Rabbits
e. Gene Engineering of VP60
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
f. Vector:
pcDNA3.1(+) (Yuan et al., 2013)
g. Immunization Route
Intramuscular injection (i.m.)
h. Rabbit Response
  • Vaccine Immune Response Type: VO_0003057
  • Immune Response: In all cases, the rabbits immunized with pcDNA-VP60 developed high level of RHDV-specific antibodies and cellular immune response (Yuan et al., 2013).
  • Efficacy: The rabbits inoculated with PBS and pcDNA3.1(+) were not protected from the RHDV challenge and developed high fever and oronasal hemorrhage, and died within two days after challenge as a consequence of the viral infection. All pcDNA-VP60 and RHDV inactive vaccine vaccinated rabbits survived (Yuan et al., 2013).
3. rORFV-RHDV-VP60
a. Vaccine Ontology ID:
VO_0004767
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Rabbit
e. Gene Engineering of VP60
  • Type: Recombinant protein preparation
  • Description: Recombinant Orf virus (ORFV; Parapoxvirus) expressing the major capsid protein VP1 (VP60) of the calicivirus, rabbit hemorrhagic disease virus (RHDV) (Rohde et al., 2011).
  • Detailed Gene Information: Click here.
f. Preparation
(Rohde et al., 2011) Anew recombinant Orf virus (ORFV; Parapoxvirus) expressing the major capsid protein VP1 (VP60) of RHDV.
g. Immunization Route
Intramuscular injection (i.m.)
h. Rabbit Response
  • Vaccination Protocol: The animals were immunized once, twice or 3-times by the intramuscular (i.m.) route with 1 ml D1701-V-VP1 containing 107 PFU (plaque-forming units), 106 PFU, or 105 PFU, respectively. For controls, groups of rabbits were vaccinated with the commercial RHDV vaccine “RIKA-VACC” (Riemser Arzneimittel AG, Germany) or remained non-vaccinated (Rohde et al., 2011).
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: Twenty two days after the last vaccination, the animals were inoculated i.m. with 1 ml containing 104 LD50 (lethal dose 50) of the virulent RHDV strain “Eisenhüttenstadt” (Rohde et al., 2011).
  • Efficacy: All animals immunized with the ORFV-vectored vaccine survived without any clinical signs, similar to animals control immunized with the commercially available inactivated RHDV vaccine RIKA-VACC. As expected, all non-immunized rabbits died within 48 h after challenge with RHD-specific clinical symptoms (Rohde et al., 2011).
IV. References
1. Fischer et al., 1997: Fischer L, Le Gros FX, Mason PW, Paoletti E. A recombinant canarypox virus protects rabbits against a lethal rabbit hemorrhagic disease virus (RHDV) challenge. Vaccine. 1997; 15(1); 90-96. [PubMed: 9041672].
2. Rohde et al., 2011: Rohde J, Schirrmeier H, Granzow H, Rziha HJ. A new recombinant Orf virus (ORFV, Parapoxvirus) protects rabbits against lethal infection with rabbit hemorrhagic disease virus (RHDV). Vaccine. 2011; 29(49); 9256-9264. [PubMed: 22001119].
3. Wiki: Rabbit haemorrhagic disease: Rabbit haemorrhagic disease [https://en.wikipedia.org/wiki/Rabbit_haemorrhagic_disease]
4. Yuan et al., 2013: Yuan D, Qu L, Liu J, Guo D, Jiang Q, Lin H, Si C. DNA vaccination with a gene encoding VP60 elicited protective immunity against rabbit hemorrhagic disease virus. Veterinary microbiology. 2013; 164(1-2); 1-8. [PubMed: 23419819].