VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Reticuloendotheliosis Virus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
  2. Vaccine Related Pathogen Genes
    1. env (Protective antigen)
    2. gag (Protective antigen)
    3. VP22 (Protective antigen)
  3. Vaccine Information
    1. REV DNA vaccine VP22/gag and VP22/env
  4. References
I. General Information
1. NCBI Taxonomy ID:
11636
2. Disease:
Tumors, wasting syndrome
3. Introduction
REV is a group of avian viruses in the family Retroviridae, specifically gammaretroviruses in the same genus as mammalian C-type retroviruses. The viruses included in this group are REV strains such as REV-T (replication defective and tumorigenic); REV-A (REV-T helper, replication competent); spleen necrosis virus; chick syncytial virus; duck infectious anemia virus; and other isolates obtained from turkeys, chickens, ducks, pheasants, geese, and prairie chickens. Notably, REV infection of captive prairie chicken can result in a high incidence (up to 100% of infected birds in some outbreaks) of tumors and wasting syndrome, and this infection has had a severe impact on the APC recovery program (Collisson, pers. obs.). Once detected, infected birds were removed from breeding populations, significantly reducing the genetic pool and the number of birds that can be released or kept as breeders. REV infection has been associated with acute reticular cell neoplasia, wasting disease, and chronic cell neoplasia of lymphoid and nonlymphoid tissues (Drechsler et al., 2013).
1. env
  • Gene Name : env
  • Sequence Strain (Species/Organism) : Reticuloendotheliosis virus strain APC-566
  • NCBI Protein GI : 88605105
  • Other Database IDs : CDD:278837
    CDD:197368
  • Taxonomy ID : 11636
  • Gene Strand (Orientation) : ?
  • Protein Name : env protein
  • Protein pI : 6.13
  • Protein Weight : 60964.83
  • Protein Length : 650
  • Protein Note : ENV polyprotein (coat polyprotein); pfam00429
  • Protein Sequence : Show Sequence
    >ABD46830.1 env protein [Reticuloendotheliosis virus]
    MDCLTNLRSAEGKVDQAGKTLILLVVWWGFGTTAEGYPLQQLWGLPCDCSGGYVFSIPTYYTNSLDCGSS
    TAYLTYGSGTGSWGWGGGFRQQWECVFKPKIIPSVQGQPGPCPSECLTIATQMHSTCYEKAQECTLLGKT
    YFTAILQKTKLGSYEDGPNKLLQASCTGTIGKPVCWDPVAPVYVSDGGGPTDMIREESVRERLEEIIRHS
    YPSVQYHPLALPRPRGVDLDPQTYDILEATHQVLNATNPQLAENCWLCMTLGTPIPAAIPANGNVTLDGN
    CSLSLPFRVQPTGSIDVNCYAGEADNRTGIPIGYVHFTNCTSIQEVSNETSHIRNLTRLCPPPGHVFVCG
    NNMAYTALPNKWIGLCILASIVPDMSIISGEEPIPLPSIEYTAGRHKRAVQFIPLLVGLGITGATLAGGT
    GLGVSVHTYHKLSNQLIEDVQALSGTINDLQDQIDSLAEVVLQNRRGLDLLTAEQGGICLALQEKCCFYA
    NKSGIVRDKIRKLQEDLIARKRALYDNPLWNGLNGFLPYLLPLLGPLFGLILFLTLGPCIIKTLTRIIHD
    KIQAVKILALVPQYKPLPTEMDTLGQ
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): REV DNA vaccine VP22/gag and VP22/env
2. gag
  • Gene Name : gag
  • Sequence Strain (Species/Organism) : Reticuloendotheliosis virus strain APC-566
  • NCBI Protein GI : 88605103
  • Other Database IDs : CDD:307339
    CDD:307969
    CDD:197667
  • Taxonomy ID : 11636
  • Gene Strand (Orientation) : ?
  • Protein Name : gag protein
  • Protein pI : 8.36
  • Protein Weight : 53536.51
  • Protein Length : 562
  • Protein Note : Matrix protein (MA), p15; pfam01140
  • Protein Sequence : Show Sequence
    >ABD46828.1 gag protein [Reticuloendotheliosis virus]
    MGQAGSKGLLTPLECILKNFSDFKKRAGDYGEDVDSFTLRKLCELEWPTFGVGWPKEGTLDFRVVAAVRN
    IVFGNPGHPDQVIYITVWIDITIERPKYLKDCGCKPTGPSKVLLASQKVNPRRPVLPSAPESPPRMRRAQ
    FLDERPLSPAPAPPPPYPEVPAIAEEGEEGQQPDSTVMASPPHTRSGLEFGAQGPSGMYPLRETGERDMG
    GRPMRTYVPFTTSDLYNWKNQNPSFSQAPDEVISLLESVFYTHQPTWDDCQQLLRTLFTTEERERVRTES
    RREVRNDQGVQVTDEREIEAQFPATRPDWDPNTGRGNDNLERYRQILLRGLRAAARKPTNLSKITEVRQG
    ADESPTAYLERLYQAYRTWSPIDPRAPENQAAIVIQFVSQSAPDIRKKIQKIDGFQGKSLSELVAIAQKV
    FDQREDPAKATHELTQKMAKVLLAQESRAERGSKKTPPGKGRPPLGKNQCAYCKEEGHWKKNCPKLVSGA
    TPVLVEELQ
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): REV DNA vaccine VP22/gag and VP22/env
3. VP22
  • Gene Name : VP22
  • Sequence Strain (Species/Organism) : Gallid herpesvirus 2 strain CVI988/Rispens
  • NCBI Protein GI : 33090005
  • Other Database IDs : CDD:309800
  • Taxonomy ID : 10390
  • Gene Strand (Orientation) : ?
  • Protein Name : VP22
  • Protein pI : 10.7
  • Protein Weight : 26320.06
  • Protein Length : 293
  • Protein Note : Herpesvirus UL49 tegument protein; pfam04823
  • Protein Sequence : Show Sequence
    >AAP93873.1 VP22 [Gallid alphaherpesvirus 2]
    MGDSERRKSERRRSLGYPSAYDDVSIPARRPSTRTQRNLNQDDLSKHGPFTDHPTQKYKSAKAVSEDVSS
    TTRGGFTNKPRAKPGVRAVQSNKFAFSTAPSSASSTWRSNTVAFNQRMFCGAVATVAQYHAYQGALALWR
    QDPPRTNEELDAFLSRAVIKITIQEGPNLMGEAETCARKLLEESGLSQGNENVKSKSERTRRGGEIEIKS
    PDPGSHRTHNPRTPATSRRHHSSARGYRGSDSE
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): REV DNA vaccine VP22/gag and VP22/env
III. Vaccine Information
1. REV DNA vaccine VP22/gag and VP22/env
a. Vaccine Ontology ID:
VO_0004588
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Prairie chickens
e. Gene Engineering of env
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
f. Gene Engineering of gag
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
g. Gene Engineering of VP22
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
h. Vector:
pcDNA3.1 (Drechsler et al., 2013)
i. Immunization Route
Intramuscular injection (i.m.)
j. Chicken Response
  • Vaccination Protocol: Four birds (two males, two females) were vaccinated four times with a combination of 500 μg of VP22/gag and 250 μg of VP22/env plasmids expressing the fusion proteins (Drechsler et al., 2013).
  • Vaccine Immune Response Type: VO_0003057
  • Efficacy: The DNA vaccine containing REV proteins env and gag protected against infection early after birds were repeatedly inoculated with large doses of vaccine (500 μg) as evidenced by the lack of proviral DNA in lymphocytes of the vaccinated birds at 4 wk postchallenge. In contrast, nested PCR 4 wk postinfection showed REV proviral DNA in several of the PBS and vector mock-vaccinated control birds. However, 8 wk postinfection, two out of three vaccinated birds tested positive for REV, and all birds were positive 12 wk postinfection, showing that the vaccine delayed, thus inhibited, the onset of viral replication (Drechsler et al., 2013).
IV. References