VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

chikungunya virus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Introduction
  2. Vaccine Related Pathogen Genes
    1. E2 protein (Protective antigen)
  3. Vaccine Information
    1. MVA-CHIKV
  4. References
I. General Information
1. NCBI Taxonomy ID:
37124
2. Introduction
The emerging chikungunya virus (CHIKV) causes a severe disease in humans (García-Arriaza et al., 2014).
1. E2 protein
  • Gene Name : E2 protein
  • Sequence Strain (Species/Organism) : chikungunya virus
  • NCBI Protein GI : AEJ18140
  • Other Database IDs : CDD:279311
  • Taxonomy ID : 37124
  • Protein Name : E2 protein
  • Protein pI : 7.78
  • Protein Weight : 44672.18
  • Protein Length : 483
  • Protein Note : Alphavirus E2 glycoprotein; pfam00943
  • Protein Sequence : Show Sequence
    >AEJ18140.1 E2 protein, partial [Chikungunya virus]
    STKDNFNVYKATRPYLAHCPDCGEGHSCHSPVALERIRNEATDGTLKIQVSLQIGIKTDDSHDWTKLRYM
    DNHMPADAERAGLFVRTLAPCTITGTMGHFILARCPKGETLTVGFTDSRKISHSCTHPFHHDPPVIGREK
    FHSRPQHGKELPCSTYVQSTAATTEEIEVHMPPDTPDHTLMSQQSGNVKITVNGQTVRYKCNCGGSNEGL
    TTTDKVINNCKVDQCHAAVTNHKKWQYNSPLVPRNAELGDRKGKIHIPFPLANVTCRVPKARNPTVTYGK
    NQVIMLLYPDHPTLLSYRNMGEEPNYQEEWVMHKKEVVLTVPTEGLEVTWGNNEPYKYWPQLSTNGTAHG
    HPHEIILYYYELYPTMTVVVVSVATFILLSMVGMAAGMCMCARRRCITPYELTPGATVPFLLSLICCIRT
    AKA
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Lam et al., 2015)
III. Vaccine Information
1. MVA-CHIKV
a. Vaccine Ontology ID:
VO_0004666
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Preparation
The highly attenuated poxvirus vector modified vaccinia virus Ankara (MVA) was used to express the CHIKV C, E3, E2, 6K, and E1 structural genes (termed MVA-CHIKV) (García-Arriaza et al., 2014).
f. Immunization Route
Intramuscular injection (i.m.)
g. Mouse Response
IV. References
1. García-Arriaza et al., 2014: García-Arriaza J, Cepeda V, Hallengärd D, Sorzano CÓ, Kümmerer BM, Liljeström P, Esteban M. A novel poxvirus-based vaccine, MVA-CHIKV, is highly immunogenic and protects mice against chikungunya infection. Journal of virology. 2014; 88(6); 3527-3547. [PubMed: 24403588].
2. Lam et al., 2015: Lam S, Nyo M, Phuektes P, Yew CW, Tan YJ, Chu JJ. A potent neutralizing IgM mAb targeting the N218 epitope on E2 protein protects against Chikungunya virus pathogenesis. mAbs. 2015; 7(6); 1178-1194. [PubMed: 26305993].