VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

African horse sickness virus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
  2. Vaccine Related Pathogen Genes
    1. NS1 (Protective antigen)
    2. VP2 (Protective antigen)
    3. VP7 (Protective antigen)
  3. Vaccine Information
    1. ALVAC-AHSV
    2. rMVA- AHS-VP2
  4. References
I. General Information
1. NCBI Taxonomy ID:
40050
1. NS1
  • Gene Name : NS1
  • Sequence Strain (Species/Organism) : African horse sickness virus
  • NCBI Protein GI : AKP39984
  • Other Database IDs : CDD:279979
  • Taxonomy ID : 36421
  • Protein Name : NS1
  • Protein pI : 6.65
  • Protein Weight : 59621.73
  • Protein Length : 606
  • Protein Note : passage history: 1# BHK
  • Protein Sequence : Show Sequence
    >AKP39984.1 NS1 [African horse sickness virus 4]
    MDRFLTYFQVRGERANAVRLFGEISEQIDCSHLKRDCFVNGICARQHFKECCNIATDNGSRTNADKLVAL
    ALRALLDRQTIWTCVIKNADYVSQYADEQMEEEVNKLYDVYLQSGTREEFEGFRQRNRPSRVVMDDSCSM
    LSYFYIPMNQGNPAPVAKLSRWGQFGICYYDRTNVDGLIPYDEIGLAQAIDGLKDLIEGRLPVCPYTGAN
    GRINAVLHLPLEMEVIMAVQENATQLMRRAAQDFKFITHAGWRLYPRLLRQRFAIEDATEGVIHHVMLGH
    LRYYDEDTSIVKYRFLNDGSLDWRTWTIPLHLMRTARLGHLQPESILVFMHKKLTCQVCFMVDLALLDTI
    PVVDSKIAELTGGTDVFYTRAYVHADNHKVPNVRDLMMNEVFRKIDDHWVIQKCHTTKEAITVTAIQIQR
    SIRGDGQWDTPMFHQSMALLTRLIVYWLTDVTERSAIFRLTCFAIFGCKPTARGRYIDWDDLGTFMKNVL
    DGRDLTVLEDETCFISMMRMAMLHVQRSKVVCATVLEAPLEIQQVGQIVEVPFDFMHN
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (de et al., 2015)
2. VP2
  • Gene Name : VP2
  • Sequence Strain (Species/Organism) : African horse sickness virus
  • NCBI Protein GI : CDJ98824
  • Other Database IDs : CDD:279269
  • Taxonomy ID : 40050
  • Protein Name : VP2
  • Protein pI : 8.83
  • Protein Weight : 9039.572
  • Protein Length : 141
  • Protein Note : Orbivirus outer capsid protein VP2; pfam00898
  • Protein Sequence : Show Sequence
    >CDJ98824.1 VP2, partial [African horse sickness virus]
    WVXWVVNYIMLSHVKRLVKDYKFKKLQPDNLMSGMNKLVGALRCYAYCLILALYDHFGAEIEGFRKGTNA
    ASIVETVSQMFP
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Manning et al., 2017)
3. VP7
  • Gene Name : VP7
  • Sequence Strain (Species/Organism) : African horse sickness virus
  • NCBI Protein GI : AKP39983
  • Other Database IDs : CDD:279268
  • Taxonomy ID : 36421
  • Protein Name : VP7
  • Protein pI : 6.27
  • Protein Weight : 34424.22
  • Protein Length : 404
  • Protein Note : passage history: 1# BHK
  • Protein Sequence : Show Sequence
    >AKP39983.1 VP7 [African horse sickness virus 4]
    MDAIAARALSVVRACVTVTDARVSLDPGVMETLGIAINRYNGLTNHSVSMRPQTQAERNEMFFMCTDMVL
    AALNVQIGNISPDYDQALATVGALATTEIPYNVQAMNDIVRITGQMQTFGPSKVQTGPYAGAVEVQQSGR
    YYVPQGRTRGGYINSNIAEVCMDAGAAGQVNALLAPRRGDAVMIYFVWRPLRIFCDPQGASLESAPGTFV
    TVDGVNVAAGDVVAWNTIAPVNVGNPGARRSILQFEVLWYTSLDRSLDTVPELAPTLTRCYAYVSPTWHA
    LRAVIFQQMNMQPINPPIFPPTERNEIVAYLLVASLADVYAALRPDFRMNGVVAPVGQINRALVLAAYH
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Rutkowska et al., 2011)
III. Vaccine Information
1. ALVAC-AHSV
a. Vaccine Ontology ID:
VO_0004725
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Preparation
Recombinant canarypox virus vector (ALVAC-AHSV) co-expressing synthetic genes encoding the outer capsid proteins (VP2 and VP5) of AHSV serotype 4 (AHSV-4) (Guthrie et al., 2009).
f. Immunization Route
Intramuscular injection (i.m.)
g. Horse Response
  • Vaccination Protocol: Two groups of four horses each (two males and two females) were inoculated intramuscularly with 107.1 or 106.4 TCID50, respectively, of ALVAC–AHSV in approximately 1 ml of diluent containing a Carbopol® 974P adjuvant (BF Goodrich) (Guthrie et al., 2009).
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: All nine horses were challenged by intravenous inoculation of 105.5 TCID50 of AHSV-4 at 28 days after the second vaccination (week 8) (Guthrie et al., 2009).
  • Efficacy: Post challenge, all horses remained healthy and showed no adverse effects after vaccination (Guthrie et al., 2009).
2. rMVA- AHS-VP2
a. Vaccine Ontology ID:
VO_0004758
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Preparation
Recombinant vaccine based on modified vaccinia Ankara expressing AHS-4 VP2 (MVA-VP2) (Castillo-Olivares et al., 2011).
f. Immunization Route
Intramuscular injection (i.m.)
g. Mouse Response
  • Vaccination Protocol: The mice were vaccinated by the intra-peritoneal route on days 0 and 28 with 107 pfu of MVA-VP2 per mouse (Castillo-Olivares et al., 2011).
  • Vaccine Immune Response Type: VO_0000287
  • Challenge Protocol: The mice were subsequently challenged on day 35 with 106 pfu of AHSV-4 (Castillo-Olivares et al., 2011).
  • Efficacy: All of the MVA-VP2 vaccinated animals were also protected from clinical signs and were completely healthy until the end of the study period (Castillo-Olivares et al., 2011).
IV. References
1. Castillo-Olivares et al., 2011: Castillo-Olivares J, Calvo-Pinilla E, Casanova I, Bachanek-Bankowska K, Chiam R, Maan S, Nieto JM, Ortego J, Mertens PP. A modified vaccinia Ankara virus (MVA) vaccine expressing African horse sickness virus (AHSV) VP2 protects against AHSV challenge in an IFNAR -/- mouse model. PloS one. 2011; 6(1); e16503. [PubMed: 21298069].
2. de et al., 2015: de la Poza F, Marín-López A, Castillo-Olivares J, Calvo-Pinilla E, Ortego J. Identification of CD8 T cell epitopes in VP2 and NS1 proteins of African horse sickness virus in IFNAR(-/-) mice. Virus research. 2015; 210; 149-153. [PubMed: 26272673].
3. Guthrie et al., 2009: Guthrie AJ, Quan M, Lourens CW, Audonnet JC, Minke JM, Yao J, He L, Nordgren R, Gardner IA, Maclachlan NJ. Protective immunization of horses with a recombinant canarypox virus vectored vaccine co-expressing genes encoding the outer capsid proteins of African horse sickness virus. Vaccine. 2009; 27(33); 4434-4438. [PubMed: 19490959].
4. Manning et al., 2017: Manning NM, Bachanek-Bankowska K, Mertens PPC, Castillo-Olivares J. Vaccination with recombinant Modified Vaccinia Ankara (MVA) viruses expressing single African horse sickness virus VP2 antigens induced cross-reactive virus neutralising antibodies (VNAb) in horses when administered in combination. Vaccine. 2017; 35(44); 6024-6029. [PubMed: 28438410].
5. Rutkowska et al., 2011: Rutkowska DA, Meyer QC, Maree F, Vosloo W, Fick W, Huismans H. The use of soluble African horse sickness viral protein 7 as an antigen delivery and presentation system. Virus research. 2011; 156(1-2); 35-48. [PubMed: 21195731].