VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

rinderpest virus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
  2. Vaccine Related Pathogen Genes
    1. H protein (Protective antigen)
    2. RPVgp5 F (Protective antigen)
    3. RPVgp6 H (Protective antigen)
  3. Vaccine Information
    1. rFP-RPV-H/F
    2. rLSDV-RPV
    3. v2RVFH
  4. References
I. General Information
1. NCBI Taxonomy ID:
11241
1. H protein
  • Gene Name : H protein
  • Sequence Strain (Species/Organism) : rinderpest virus
  • NCBI Protein GI : YP_087125
  • Other Database IDs : CDD:271231
    GOA:Q629I1
    InterPro: IPR000665
    InterPro: IPR011040
    UniProtKB/TrEMBL: Q629I1
  • Taxonomy ID : 11242
  • Protein Name : H protein
  • Protein pI : 7.44
  • Protein Weight : 64611.9
  • Protein Length : 679
  • Protein Note : Measles virus hemagglutinin; cd15467
  • Protein Sequence : Show Sequence
    >YP_087125.2 H protein [Rinderpest virus (strain Kabete O)]
    MSPPRDRVDAYYKDNFQFKNTRVVLNKEQLLIERPCMLLTVLFVMFLSLVGLLAIAGIRLHRAAVNTAKI
    NNDLTTSIDITKSIEYQVKDVLTPLFKIIGDEVGLRTPQRFTDLTKFISDKIKFLNPDKEYDFRDINWCI
    NPPERIKIDYDQYCAHTAAEDLITMLVNSSLTGTTVLRTSLVNLGRNCTGPTTTKGQFSNISLTLSGIYS
    GRGYNISSMITITGKGMYGSTYLVGKYNQRARRPSIVWQQDYRVFEVGIIRELGVGTPVFHMTNYLELPR
    QPELETCMLALGESKLAALCLADSPVALHYGRVGDDNKIRFVKLGVWASPADRDTLATLSAIDPTLDGLY
    ITTHRGIIAAGTAIWAVPVTRTDDQVKMGKCRLEACRDRPPPFCNSTDWEPLEAGRIPAYGVLTIKLGLA
    DEPKVDIISEFGPLITHDSGMDLYTSFDGTKYWLTTPPLQNSALGTVNTLVLEPSLKISPNILTLPIRSG
    GGDCYTPTYLSDRADDDVKLSSNLVILPSRDLQYVSATYDISRVEHAIVYHIYSTGRLSSYYYPFKLPIK
    GDPVSLQIECFPWDRKLWCHHFCSVIDSGTGEQVTHIGVVGIEITCNGK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Khandelwal et al., 2004)
2. RPVgp5 F
  • Gene Name : RPVgp5 F
  • Sequence Strain (Species/Organism) : Rinderpest virus (strain Kabete O)
  • NCBI Gene ID : 3021776
  • NCBI Protein GI : 56410434
  • Locus Tag : RPVgp5
  • Genbank Accession : X98291
  • Protein Accession : YP_087124
  • Taxonomy ID : 11242
  • Gene Starting Position : 5457
  • Gene Ending Position : 7097
  • Gene Strand (Orientation) : +
  • Protein Name : F protein
  • Protein pI : 8.22
  • Protein Weight : 55061.12
  • Protein Length : 546
  • DNA Sequence : Show Sequence
    >NC_006296.2:5457-7097 Rinderpest virus (strain Kabete O), complete genome
    CATGAAGATCTTATTTGCTACCCTGCTAGTAGTGACCACCCCTCACTTAGTCACTGGCCAGATCCACTGG
    GGCAATCTTTCGAAAATTGGAGTCGTAGGGACGGGTAGTGCTAGTTACAAGGTGATGACCCAATCGAGTC
    ACCAGACACTAGTTATAAAGCTGATGCCCAATATCACCGCTATAGACAACTGCACTAAGACTGAGATTGA
    GGAGTATAAGAGGCTGTTGGGGACAGTGCTTCAGCCTATTAAGGTCGCTCTGAACGCCATTACTAAGAAT
    ATAAAACCAATCAGGAGTTCCACTACCAGTAGGAGACACAGAAGGTTCGCAGGGGTCGCTTTGGCTGGTG
    CAGCTCTCGGAGTTGCAACCGCAGCCCAGATTACAGCAGGGATTGCTCTTCATCAATCAATGATGAATAC
    CCAGGCTATTGAAAGTCTTAAGGCAAGTCTGGAAACAACTAATCAAGCAATTGAGGAAATACGACAAGCA
    GGCCAAGAAATGATCCTAGCAGTTCAAGGTGTCCAGGACTACATCAACAATGAACTGGTACCTGCAATGG
    GCCAATTATCGTGTGATATCGTGGGTCAGAAGCTAGGGCTGAAACTGCTCAGATACTACACTGAAATATT
    ATCATTATTTGGCCCCAGCCTCAGAGACCCAATTTCGGCCGAGATTTCTATCCAGGCTTTGAGTTACGCC
    TTAGGTGGGGACATAAACAAAATACTAGAAAAGCTAGGGTATAGCGGGAGTGATCTCCTTGCTATACTGG
    AAAGTAAAGGTATCAAAGCTAAGATAACCTATGTGGATATCGAAAGTTACTTCATTGTGCTCAGCATTGC
    CTATCCTTCGCTTTCTGAAATTAAAGGGGTGATAATTCATCGCCTGGAGGGTGTCTCTTACAATATAGGG
    TCGCAGGAGTGGTATACCACAGTACCTCGATATGTGGCAACCCAAGGTTACCTCATTTCGAATTTCGATG
    ACACACCCTGTGCATTCTCCCCAGAGGGCACTATCTGCAGCCAGAATGCATTATACCCAATGAGCCCACT
    CCTCCAGGAATGTTTCCGTGGGTCAACCAGGTCATGCGCTCGTACACTGGTCTCTGGGTCTATAGGGAAT
    AGGTTTATCCTATCCAAGGGGAACCTCATTGCCAACTGTGCCTCAATCTTGTGCAAGTGTTACACCACTG
    GCTCAATAATAAGTCAAGATCCTGACAAGATCCTAACATATATAGCTGCAGACCAATGCCCCATCGTAGA
    AGTGGACGGTGTAACCATCCAGGTTGGGAGCAGAGAGTACCCTGATGCAGTGTACCTGCATAAAATAGAC
    CTTGGCCCACCAATATCGCTGGAGAAGCTAGATGTTGGGACTAACCTCGGCAATGCAGTGACAAAACTGG
    AGAAAGCCAAGGATCTACTAGATTCATCTGATCTGATCCTGGAAACCATCAAGGGTGCTTCAGTCACGAA
    CACAGGCCATATTCTAGTTGGAGCCGGGTTGATTGCAGTAGTGGGTATCCTCATTGTTACCTGTTGCTGT
    AGGAAGCGCAGTAATGACAGCAAAGTGTCCACTGTGATATTGAATCCGGGTCTTAAACCAGACCTCACTG
    GTACATCCAAATCCTACGTACGGTCACTGTA
    
    
  • Protein Sequence : Show Sequence
    >YP_087124.2 F protein [Rinderpest virus (strain Kabete O)]
    MKILFATLLVVTTPHLVTGQIHWGNLSKIGVVGTGSASYKVMTQSSHQTLVIKLMPNITAIDNCTKTEIE
    EYKRLLGTVLQPIKVALNAITKNIKPIRSSTTSRRHRRFAGVALAGAALGVATAAQITAGIALHQSMMNT
    QAIESLKASLETTNQAIEEIRQAGQEMILAVQGVQDYINNELVPAMGQLSCDIVGQKLGLKLLRYYTEIL
    SLFGPSLRDPISAEISIQALSYALGGDINKILEKLGYSGSDLLAILESKGIKAKITYVDIESYFIVLSIA
    YPSLSEIKGVIIHRLEGVSYNIGSQEWYTTVPRYVATQGYLISNFDDTPCAFSPEGTICSQNALYPMSPL
    LQECFRGSTRSCARTLVSGSIGNRFILSKGNLIANCASILCKCYTTGSIISQDPDKILTYIAADQCPIVE
    VDGVTIQVGSREYPDAVYLHKIDLGPPISLEKLDVGTNLGNAVTKLEKAKDLLDSSDLILETIKGASVTN
    TGHILVGAGLIAVVGILIVTCCCRKRSNDSKVSTVILNPGLKPDLTGTSKSYVRSL
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): v2RVFH
3. RPVgp6 H
  • Gene Name : RPVgp6 H
  • Sequence Strain (Species/Organism) : Rinderpest virus (strain Kabete O)
  • NCBI Gene ID : 3021774
  • NCBI Protein GI : 56410435
  • Locus Tag : RPVgp6
  • Genbank Accession : X98291
  • Protein Accession : YP_087125
  • Taxonomy ID : 11242
  • Gene Starting Position : 7258
  • Gene Ending Position : 9087
  • Gene Strand (Orientation) : +
  • Protein Name : H protein
  • Protein pI : 7.04
  • Protein Weight : 63930.13
  • Protein Length : 609
  • DNA Sequence : Show Sequence
    >NC_006296.2:7258-9087 Rinderpest virus (strain Kabete O), complete genome
    CATGTCTCCCCCAAGAGACAGGGTCGACGCTTACTACAAGGACAACTTCCAATTCAAGAACACTCGGGTG
    GTTCTTAATAAAGAGCAGCTCCTGATAGAGAGACCTTGCATGTTGCTGACGGTGTTGTTTGTCATGTTCC
    TGAGTCTAGTCGGGCTATTAGCTATCGCAGGTATCAGACTCCATCGAGCTGCTGTCAATACAGCAAAAAT
    CAACAATGACCTGACAACAAGTATTGATATTACCAAATCCATTGAGTACCAGGTCAAGGATGTTTTAACT
    CCACTCTTCAAAATAATTGGAGATGAGGTCGGGTTGAGGACGCCTCAGAGATTCACAGATCTGACTAAAT
    TCATATCAGACAAGATCAAGTTCCTTAACCCTGATAAGGAGTACGACTTTAGAGATATCAACTGGTGCAT
    CAACCCTCCAGAGAGAATTAAGATTGATTATGATCAGTATTGTGCTCACACAGCAGCTGAGGATCTGATA
    ACAATGCTTGTCAATTCATCCTTAACAGGGACTACAGTACTCCGCACGTCATTAGTCAACTTGGGGAGGA
    ACTGTACTGGACCCACAACCACTAAGGGTCAGTTCTCTAATATATCATTGACCCTTTCCGGGATATACTC
    AGGTCGTGGCTACAACATTTCATCTATGATCACTATTACTGGGAAAGGCATGTACGGGAGCACTTATCTG
    GTCGGGAAATACAATCAAAGAGCCAGGAGGCCAAGCATAGTATGGCAACAGGATTACCGAGTCTTCGAAG
    TAGGCATAATTAGAGAACTAGGAGTGGGCACACCAGTGTTTCATATGACAAACTACCTGGAACTTCCAAG
    ACAGCCGGAATTGGAGACTTGCATGCTAGCCCTAGGAGAGTCCAAATTAGCTGCCCTCTGCCTAGCTGAC
    AGCCCCGTCGCACTGCACTACGGGAGGGTAGGAGACGACAACAAGATCAGATTTGTCAAATTGGGAGTAT
    GGGCATCACCGGCCGACCGAGACACTTTGGCCACTCTTTCAGCAATAGACCCGACATTGGACGGACTCTA
    TATCACAACTCATAGGGGGATCATAGCTGCAGGGACTGCCATATGGGCTGTCCCTGTGACGAGAACAGAT
    GACCAAGTGAAAATGGGAAAGTGCCGCCTAGAGGCTTGTCGAGACAGACCACCACCTTTCTGTAACAGTA
    CAGATTGGGAGCCACTAGAGGCTGGCCGAATACCGGCGTATGGAGTACTAACCATCAAACTAGGGCTGGC
    TGATGAGCCTAAAGTTGACATAATTTCAGAATTTGGTCCTCTAATCACCCATGACTCAGGGATGGATTTA
    TACACCTCATTTGACGGTACCAAGTACTGGTTGACTACTCCTCCATTGCAGAACTCAGCTCTAGGAACTG
    TGAACACCCTAGTTTTAGAGCCCAGTCTCAAAATTAGTCCTAACATCCTTACTCTCCCCATCAGGTCGGG
    AGGGGGTGACTGTTATACTCCTACTTACCTGTCAGACCGGGCTGACGATGATGTTAAATTGAGCTCCAAT
    CTTGTAATCCTCCCAAGTAGGGACCTCCAATATGTGTCTGCAACCTACGACATCTCCAGAGTTGAACATG
    CCATTGTGTACCACATCTATAGTACCGGGCGACTATCATCGTATTACTACCCTTTCAAGTTGCCCATAAA
    GGGAGATCCTGTCAGTCTGCAGATCGAATGCTTCCCGTGGGACCGCAAACTGTGGTGCCATCATTTCTGC
    TCTGTTATAGATTCAGGGACTGGTGAGCAGGTCACCCATATAGGGGTAGTAGGGATTGAGATCACTTGCA
    ATGGGAAATA
    
    
  • Protein Sequence : Show Sequence
    >YP_087125.2 H protein [Rinderpest virus (strain Kabete O)]
    MSPPRDRVDAYYKDNFQFKNTRVVLNKEQLLIERPCMLLTVLFVMFLSLVGLLAIAGIRLHRAAVNTAKI
    NNDLTTSIDITKSIEYQVKDVLTPLFKIIGDEVGLRTPQRFTDLTKFISDKIKFLNPDKEYDFRDINWCI
    NPPERIKIDYDQYCAHTAAEDLITMLVNSSLTGTTVLRTSLVNLGRNCTGPTTTKGQFSNISLTLSGIYS
    GRGYNISSMITITGKGMYGSTYLVGKYNQRARRPSIVWQQDYRVFEVGIIRELGVGTPVFHMTNYLELPR
    QPELETCMLALGESKLAALCLADSPVALHYGRVGDDNKIRFVKLGVWASPADRDTLATLSAIDPTLDGLY
    ITTHRGIIAAGTAIWAVPVTRTDDQVKMGKCRLEACRDRPPPFCNSTDWEPLEAGRIPAYGVLTIKLGLA
    DEPKVDIISEFGPLITHDSGMDLYTSFDGTKYWLTTPPLQNSALGTVNTLVLEPSLKISPNILTLPIRSG
    GGDCYTPTYLSDRADDDVKLSSNLVILPSRDLQYVSATYDISRVEHAIVYHIYSTGRLSSYYYPFKLPIK
    GDPVSLQIECFPWDRKLWCHHFCSVIDSGTGEQVTHIGVVGIEITCNGK
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): v2RVFH
III. Vaccine Information
1. rFP-RPV-H/F
a. Vaccine Ontology ID:
VO_0004752
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Preparation
Rinderpest virus (RPV) antigens, expressed in pox virus vectors (Jones et al., 1997).
f. Immunization Route
Intramuscular injection (i.m.)
g. Ferret Response
  • Vaccination Protocol: Ferrets were inoculated intradermally with recombinant vaccinia viruses expressing the H gene of RPV, the F gene of RPV, the H and F genes of RPV, or fowlpox virus recombinant expressing both genes. Two ferrets were vaccinated s.c. with CDV vaccine as positive controls, and 1 group was left unvaccinated as a negative control (Jones et al., 1997).
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: The ferrets were challenge exposed with a high dose of CDV (Jones et al., 1997).
  • Efficacy: Partial protection was seen in all groups, with vRVFH vaccination being the most protective (Jones et al., 1997).
2. rLSDV-RPV
a. Vaccine Ontology ID:
VO_0004763
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Preparation
Recombinant capripox-rinderpest vaccine (Ngichabe et al., 2002).
f. Immunization Route
Intramuscular injection (i.m.)
g. Cattle Response
  • Vaccination Protocol: A dose of 105.3 TCID50/ml of the recombinant vaccine, determined previously as an effective dose, was injected subcutaneously in the shoulder region of each animal (Ngichabe et al., 2002).
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: Two years after vaccination, cattle were challenged with virulent RPV (Ngichabe et al., 2002).
  • Efficacy: In the case of LSDV, all of 4 vaccinated cattle challenged with virulent LSDV at 2 years were completely protected from clinical disease while 2 of 5 vaccinated cattle were completely protected at 3 years. The recombinant vaccine showed no loss of potency when stored lyophylized at 4 degrees C for up to 1 year (Ngichabe et al., 2002).
3. v2RVFH
a. Vaccine Ontology ID:
VO_0004813
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Cattle
e. Gene Engineering of RPVgp5 F
  • Type: Recombinant vector construction
  • Description: The vaccine v2RVFH is a recombinant vector vaccine that expresses two proteins including the F protein from the rinderpest virus (Verardi et al., 2002).
  • Detailed Gene Information: Click here.
f. Gene Engineering of RPVgp6 H
  • Type: Recombinant protein preparation
  • Description: The vaccine v2RVFH is a recombinant vector vaccine that expresses the H protein from a rinderpest virus (Verardi et al., 2002).
  • Detailed Gene Information: Click here.
g. Vector:
Vaccinia virus vector (Verardi et al., 2002)
h. Preparation
The v2RVFH vaccine was prepared by using a recombinant vaccinia virus vaccine to expresses both the fusion (F) and hemagglutinin (H) genes of rinderpest virus (RPV) under strong synthetic vaccinia virus promoters (Verardi et al., 2002).
i. Immunization Route
Intramuscular injection (i.m.)
j. Cattle Response
  • Host Strain: Zebu cattle
  • Vaccination Protocol: Groups of Zebu cattle (Bos indicus, 2 years old on average) vaccinated intramuscularly (1 ml) with various doses of v2RVFH at the side of the neck. Control groups were also included (Verardi et al., 2002).
  • Immune Response: Intramuscular vaccination of cattle with 108 PFU of v2RVFH provided long-term sterilizing immunity against rinderpest (Verardi et al., 2002).
  • Side Effects: The vaccine is highly safe. Animals vaccinated with v2RVFH did not develop pock lesions and did not transmit the recombinant vaccinia virus to contact animals (Verardi et al., 2002).
  • Challenge Protocol: Animals were challenged subcutaneously (1 ml) at the side of the neck with 103 to 104 TCID50 of the pathogenic Kabete ‘O’ RPV; as little as 1 TCID50 of the virus administered subcutaneously induces clinical rinderpest with 100% mortality in U.S. cattle. Nasal and ocular swabs were taken at 2, 3, 4, and 7 days postchallenge from a group of NVI animals challenged at 4 weeks postvaccination. In addition, prescapular and mesenteric lymph nodes as well as lung, spleen, tonsil, kidney, and heart tissue samples were taken from animals that died following RPV challenge. RPV isolation was attempted from the collected swabs and necropsy samples in primary calf cells (kidney and testis) and Vero cells (Verardi et al., 2002).
  • Efficacy: Cattle vaccinated intramuscularly with as little as 103 PFU of v2RVFH and challenged 1 month later with a lethal dose of RPV were completely protected from clinical disease; the 50% protective dose was determined to be 102 PFU. Animals vaccinated with v2RVFH did not develop pock lesions and did not transmit the recombinant vaccinia virus to contact animals (Verardi et al., 2002).
IV. References
1. Jones et al., 1997: Jones L, Tenorio E, Gorham J, Yilma T. Protective vaccination of ferrets against canine distemper with recombinant pox virus vaccines expressing the H or F genes of rinderpest virus. American journal of veterinary research. 1997; 58(6); 590-593. [PubMed: 9185963].
2. Khandelwal et al., 2004: Khandelwal A, Renukaradhya GJ, Rajasekhar M, Sita GL, Shaila MS. Systemic and oral immunogenicity of hemagglutinin protein of rinderpest virus expressed by transgenic peanut plants in a mouse model. Virology. 2004; 323(2); 284-291. [PubMed: 15193924].
3. Ngichabe et al., 2002: Ngichabe CK, Wamwayi HM, Ndungu EK, Mirangi PK, Bostock CJ, Black DN, Barrett T. Long term immunity in African cattle vaccinated with a recombinant capripox-rinderpest virus vaccine. Epidemiology and infection. 2002; 128(2); 343-349. [PubMed: 12002554].
4. Verardi et al., 2002: Verardi PH, Aziz FH, Ahmad S, Jones LA, Beyene B, Ngotho RN, Wamwayi HM, Yesus MG, Egziabher BG, Yilma TD. Long-term sterilizing immunity to rinderpest in cattle vaccinated with a recombinant vaccinia virus expressing high levels of the fusion and hemagglutinin glycoproteins. Journal of virology. 2002; 76(2); 484-491. [PubMed: 11752138].