VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Vibrio vulnificus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
  2. Vaccine Related Pathogen Genes
    1. rtxA1 (Protective antigen)
  3. Vaccine Information
  4. References
I. General Information
1. NCBI Taxonomy ID:
672
1. rtxA1
  • Gene Name : rtxA1
  • Sequence Strain (Species/Organism) : Vibrio vulnificus
  • NCBI Protein GI : ADX36405
  • Other Database IDs : CDD:288492
    CDD:289465
    CDD:294717
    CDD:288550
  • Taxonomy ID : 672
  • Protein Name : putative RTX-toxin
  • Protein pI : 5
  • Protein Weight : 240654.284
  • Protein Length : 2436
  • Protein Note : biotype: 1; PCR_primers=fwd_name: CMCP6-VV2-for-5370, fwd_seq: tgctgtggcgaaaagtaacg
  • Protein Sequence : Show Sequence
    >ADX36405.1 putative RTX-toxin, partial [Vibrio vulnificus]
    QINAGIRGKNSGSTISSMFTETNTDSIVVPTAASQDVVRKEIRISGVNLEGLGEASHDTAESLVSARAEK
    VANLYRWLDTDNDAATDKYVPVPGFERVDADVSDEAKERMIQFVGGYIEHTDNQVPKDQAQALATLFVEA
    TLDYDWDKRVEFLTKLESYGYSFEAPHGEKSIVSFWSGRNFKEYRNVLDNAQADGKKVVYDIDVKGNAFA
    IDLNKQLMRWGGMFLDPDNAEQNQLKSSIDAATFSNTGFWSSVYATGAQNDVYVIAEGGMRLGNYFWNVE
    LPALRQLQREGLVGEIRLLGKPVSAYKDIPVEDIGRRLTDAGVAVKVRFDALSHEKQADLLADNPDGYKA
    DTLVELDVKLSAIDSMLRESLPFYSLRTERNLLVQEGEEGFEVRSWPGTDGKSKTILLDNPEDAAQQKSI
    ERFILANFDNFEQMPDELFLVDNKVLSHHDGRTRILALKEDGAWTYNANVELMSVTELLDAAHVSGKVRG
    ESYQQVIDALTEYHASTAEHADYELTSVEKLLNLRKQVEGYVLGHPDSGRVQAMNALLNQVNSRLEAVSV
    LVVSEQSIKAHDSFSHLYDQLDNANLKESKHLYLDGNGDFVTKGKGNLANIDKLGGSGAVLEKVKAAVSH
    EYGQVVADTIFAGLSANDLAKDGKGIDIAGLNKVHQAIEQHMSPVSATMYIWKPSDHSALGHAALQIGQG
    RTQLEGQAAADFNKQNYVSWWPPGSKSSNIRNIFNVATEDQPDLKLRWSDFSQPAHQNDTLEHDMASEEN
    DGFGLKDGETKLKRFIEKLNAAKGIDASYKDASEGYASVLLGNPDMLASTGIPAHVFQPFVDQWNDTSYD
    MMDVANRFAEELQKQAQASGDPALVEKRIDNVVRLFAERAIEEIEAFKASQADEGRVFRINLEGLDVAAM
    QAEWNRLSNDPDARYQLLTKNCSSTVAKVLKAGGADKLIGHTWRPKFGVWTPTELFNFGQALQEAQLEIA
    AKKQSHQVTDVLDALSGNEKHKENVAIENDGTPPRDKESLSPLTRFLNNELYGEKDARRKIGDITQTLLD
    HAVENGESQKVTLKGEAGRLTGYYHQGAASSEGETSATSGKVVLFLHGSGSSAEEQASAIRNHYQKQGID
    MLAVNLRGYGESDGGPSEKGLYQDARTMFNYLVNDKGIDPSNIIIHGYSMGGPIAADLARYAAQNGQAVS
    GLLLDRPMPSMTKAITAHEVANPAGIVGAIAKAVNGQFSVEKNLKGLPKETPILLLTDNEGLGEEGEKLR
    AKLAIAGYNVTGEQTFYGHEASNRLMGQYTDQIVSGLFNAEQAAVEAGEVLKGLEKDFKRYGDALKPDTS
    VPGKAKDIRTTKDFLNGYKNDHAKEIVDGFRSDMNIKQLVDLFVKGNWSAEQKGALAWEIESRALKVTFQ
    NKSEKYNRLFREIASAGVVDAKATEQLAPQLMLLNLANDGFGGRCDPLSKLVLVAKQLENDGQVGVARQL
    LEKMYSAAAVLSNPTLYSDSEKANASKLLSSLAAIHAKNPMHDTSMKVWQEKLEGKQALTVNGVVEKITD
    ASANGKPVLLELDAPGQAMAAWAKGSGDDRVYGFYDPNAGIVEFSSAEKFSAYLTRFFGKSDLDMAQRYE
    LGKNAAGEPIFNRVVVMDGNTLASYKPTFGDKTTMQGILDLPVFDATPIKKPTGGVASDLEALGDKTKVV
    VDLAQIFTVQELKERAKVFAKPIGASYQGILDQLDLVHQAKGRDQIAASFELNKKINAYIAEHPTSGRNQ
    ALTQLKEQVTSALFIGKMQIAQAGIDAIAQTRPELAARIFTVAIEEANGKHVGLTDMMVRWANEDPYLAP
    KHGYKGETPSDLGFDAKYHVDLSEHYADFKQWLETSQSNGLLSKATLDESTKTVHLGYSYQELQDLTGVE
    SVQMAFYFLKEAAKKADPISGDSAEMTLLKKFADQSYLSQLDSDRMDQIEGIYRSSHETDVDAWDRRYSG
    KGYDELTNKLASATGVDEQLSVLLDDRKGLLIGEVHGSDVNGLRFVNEQMDALKKQGVTVIGLEHLRSDL
    AQPLIDRYLATGVMSSELSAMLKTKHLDVALFENARANGMRIVALDANSSARPNVQGTEHGLMYRAGAAN
    NIAVEVLQNLPDGEKFVAIYGKAHLQSHKGIEGFVPGITHRLDLPALKVSDSNQFTVEQDDVSLRVVYDD
    VANKPKITFKDSLSGANTDLHNQNVNDWERVVVTPTADGGETRFDGQIIVQMENDAVAAKAAANLAGKHP
    ESSVVVQLDSDGNYRVVYGDPSKLDGKLRWQLVGHGRDDSESNNTRLSGYSADELAVKLAKFQQSFNQAE
    NVSSKPDHISIVGCSLVSDDKQKGFGHQFIN
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Lee et al., 2014)
III. Vaccine Information
IV. References
1. Lee et al., 2014: Lee TH, Kim MH, Lee CS, Lee JH, Rhee JH, Chung KM. Protection against Vibrio vulnificus infection by active and passive immunization with the C-terminal region of the RtxA1/MARTXVv protein. Vaccine. 2014; 32(2); 271-276. [PubMed: 24252692].