VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Eimeria acervulina

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
  2. Vaccine Related Pathogen Genes
    1. hypothetical protein (Protective antigen)
  3. Vaccine Information
  4. References
I. General Information
1. NCBI Taxonomy ID:
5801
1. hypothetical protein
  • Gene Name : hypothetical protein
  • Sequence Strain (Species/Organism) : Eimeria acervulina
  • NCBI Protein GI : AFB77195
  • Taxonomy ID : 5801
  • Protein Name : hypothetical protein
  • Protein pI : 8.68
  • Protein Weight : 5170.54
  • Protein Length : 106
  • Protein Sequence : Show Sequence
    >AFB77195.1 hypothetical protein [Eimeria acervulina]
    MCSLNDLGSSTQFAAIRQCVVLRKAYTAVVHRTSTASVGPCMKMCPSLGQ
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Zhu et al., 2012)
III. Vaccine Information
IV. References
1. Zhu et al., 2012: Zhu H, Xu L, Yan R, Song X, Tang F, Wang S, Li X. Identification and characterization of a cDNA clone-encoding antigen of Eimeria acervulina. Parasitology. 2012; 139(13); 1711-1719. [PubMed: 23036233].