VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Neisseria meningitidis

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Microbial Pathogenesis
    5. Host Ranges and Animal Models
    6. Host Protective Immunity
  2. Vaccine Related Pathogen Genes
    1. ExbB (Protective antigen)
    2. GNA1030 (Protective antigen)
    3. GNA1162 (Protective antigen)
    4. GNA1220 (Protective antigen)
    5. GNA1870 (Protective antigen)
    6. GNA1946 (Protective antigen)
    7. GNA2001 (Protective antigen)
    8. GNA2091 (Protective antigen)
    9. GNA2132 (Protective antigen)
    10. GNA33 (Protective antigen)
    11. GNA992 (hsf) (Protective antigen)
    12. gp120 (Protective antigen)
    13. LctP (Protective antigen)
    14. LpdA (Protective antigen)
    15. LPS (Protective antigen)
    16. NadA (Protective antigen)
    17. NspA from N. meningitidis (Protective antigen)
    18. NspA from N. meningitidis MC58 (Protective antigen)
    19. P1 (Protective antigen)
    20. TBP2 (Protective antigen)
    21. TbpA (Protective antigen)
    22. metH (Virmugen)
    23. rfaF (Virmugen)
    24. siaD (Virmugen)
  3. Vaccine Information
    1. 5CVMB
    2. CCPS-P64kR
    3. Menactra
    4. MenHibrix
    5. Meningitec
    6. Meningococcal Polysaccharide Vaccine, Groups A & C, Menomune A/C
    7. Menjugate
    8. Menomune-A/C/Y/W-135
    9. Menveo
    10. N. meningitidis DNA vaccine P3A
    11. N. meningitidis ExbB Protein Vaccine
    12. N. meningitidis LctP Protein Vaccine
    13. N. meningitidis NspA Protein Vaccine
    14. N. meningitidis TbpA Protein Vaccine
    15. N. miningitidis TBP2 Protein Vaccine
    16. Neisseria meningitidis metH/siaD mutant vaccine
    17. Neisseria meningitidis rfaF/siaD mutant vaccine
    18. Neisvac-C
  4. References
I. General Information
1. NCBI Taxonomy ID:
487
2. Disease:
Meningitis
3. Introduction
Neisseria meningitidis, also simply known as meningococcus, is a Gram-negative β-proteobacterium and member of the bacterial family Neisseriaceaeis. There are 13 serogroups based on different capsular polysaccharide structures. Among them, six serogroups (A, B, C, W-135, X, and Y) cause most life-threatening disease (Stephens et al., 2007).
4. Microbial Pathogenesis
Meningococcus is spread through the exchange of saliva and other respiratory secretions during activities like coughing, kissing, and chewing on toys. Those with impaired immunity may be easier to get meningococcus. Meningococcal virulence is related to both capsule expression, expression of other surface structures, and underlying genotype. N meningitidis pathogenesis is related to its ability to express and modify capsule with serogroups A, B, C, W-135, X, and Y. Capsules of N meningitidis facilitate transmission and colonisation, and protect the meningococcus from desiccation, phagocytic killing, opsonisation, and complement-mediated bactericidal killing. Outer membrane proteins (e.g., PorB, PorA , Opa and Opc) contribute to meningococcal virulence. Outer membrane porins are involved in host-cell interactions and as targets for bactericidal antibodies. Endotoxin, or lipo-oligosaccharide, a major component of the outer membrane, differs in structure from enteric endotoxins and is crucial in inflammatory signalling via Toll-like receptor 4 (TLR4) (Stephens et al., 2007).
5. Host Ranges and Animal Models
It only infects humans; there is no animal reservoir.
6. Host Protective Immunity
N. mengingitidis establishes systemic infections only in individuals who lack serum bacterial antibodies directed against the capsular or noncapsular (cell wall) antigens of the invading strain, or in patients deficient in the late-acting complement components. The presence of serum bactericidal IgG and IgM is probably the most important host factor in preventing invasive disease. The role of bactericidal antibodies in prevention of invasive disease explains why high attack rates are seen in infants from 6 to 9 months old, the time at which maternal antibodies are being lost. Individuals with complement deficiencies (C5, C6, C7, or C8) may develop meningococcemia despite protective antibody. This emphasizes the importance of the complement system in defense against meningococcal disease (Textbook of Bacteriology).
1. ExbB
  • Gene Name : ExbB
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0011186
  • NCBI Gene ID : 903370
  • NCBI Protein GI : 15677575
  • Locus Tag : NMB1729
  • Genbank Accession : AE002098
  • Protein Accession : NP_274732
  • Taxonomy ID : 122586
  • Gene Starting Position : 1812128
  • Gene Ending Position : 1812790
  • Gene Strand (Orientation) : -
  • Protein Name : biopolymer transport protein
  • Protein pI : 9.81
  • Protein Weight : 22358.4
  • Protein Length : 220
  • Protein Note : identified by similarity to EGAD:145333; match to protein family HMM PF01618
  • DNA Sequence : Show Sequence
    >gi|77358697:1812128-1812790 Neisseria meningitidis MC58, complete genome
    ATCAGCTATCCTTTTGATTAAGCAGGCGGACGTGCAAATCGTGCGCCATCGCATCCAAATCCTGGGTCAG
    TATTTTTGTGCCGCGATTGAGGAAGTTGTATGCCAACACCGCCGGAATCGCCACGAACAAACCCGCCGCC
    GTCGCCACCAGTGCCTCGCCAATCGGGCCGGCAACCGCCGCAATACTCATCTGCCCGCTTTGCCCGATAT
    TGATCAGGGCGTGGTAAATCCCCCAAACCGTGCCGAACAGCCCGATAAACGGCGCGGTCGCGCCGATGGA
    GGCAAGCGCGGTCATCCCGTAATCAAACCGGCGCATAATCTGCGCCATACTGTTGCGGATTTGAATGACC
    AAATACTCGTTCAACGGCAAAGCCTGCGCCAGTTCGGACGCTTCGTTTCGGCGGTAGTTGCGGTAAGACT
    GCAATGCCTCTTGCGCCAGTTTGGACAAAGGCGCATCGACGGCGCGCACTTTTTCGACCGCGTCGTTCAG
    CGACAAAGTATCGCGCATATGCCGTTTGACGGCGGCATTCCCTTTGCGCGCCCGATACAGCTTGATGCAG
    CGCAAGACAACCAAACACCACGTTACGATACTCATCAACAGCATCAACACAAACACACCAATCAGGACGG
    GATCGCCCGATTCAAACACTAATTTCAAATTCA
  • Protein Sequence : Show Sequence
    >gi|15677575|ref|NP_274732.1| biopolymer transport protein [Neisseria meningitidis MC58]
    MNLKLVFESGDPVLIGVFVLMLLMSIVTWCLVVLRCIKLYRARKGNAAVKRHMRDTLSLNDAVEKVRAVD
    APLSKLAQEALQSYRNYRRNEASELAQALPLNEYLVIQIRNSMAQIMRRFDYGMTALASIGATAPFIGLF
    GTVWGIYHALINIGQSGQMSIAAVAGPIGEALVATAAGLFVAIPAVLAYNFLNRGTKILTQDLDAMAHDL
    HVRLLNQKDS
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : A total of 11 meningococcal proteins that are necessary for establishing systemic infection were expressed as recombinant antigens and assessed for their ability to protect mice against live bacterial challenge against N. meningitidis; ExbB, which is required for iron acquisition, elicited protective immunity (Sun et al., 2005).
  • Related Vaccine(s): N. meningitidis ExbB Protein Vaccine
2. GNA1030
  • Gene Name : GNA1030
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0010983
  • NCBI Gene ID : 903167
  • NCBI Protein GI : 15676917
  • Locus Tag : NMB1030
  • Genbank Accession : NC_003112
  • Protein Accession : NP_274064
  • Taxonomy ID : 122586
  • Gene Starting Position : 1045039
  • Gene Ending Position : 1045602
  • Gene Strand (Orientation) : -
  • Protein Name : hypothetical protein
  • Protein pI : 8.65
  • Protein Weight : 19439.53
  • Protein Length : 187
  • Protein Note : identified by similarity to EGAD:89838; match to protein family HMM PF04264
  • DNA Sequence : Show Sequence
    >gi|903167|gb|U25577.1|HIV1U25577 Human immunodeficiency virus type 1 isolate E10587A3 envelope glycoprotein (env) gene, partial cds
    GAAAATCTCACAAATAATGCCAAAACCATAATAGTACACCTTAATAGATCTGTAGAAATCAATTGTACCA
    GACCCTTCAAAATTATAAGAACAAGTACACGTATAGGACCAGGACGAGTATTCCATAAAACAGGAAGCAT
    ACTAGGAGATATAAGAAAAGCATATTGTGAGATTAATGGAACAAATTGGAATAAAGTTTTAAGGCAGGTA
    ACTAAAAAATTAAAAGAGCACTTTAAGAATAAGACAATAACCTTTCAACCACCCTCAGGAGGAGATCTAG
    AAATTACAATGCATCATTTTAATTGT
  • Protein Sequence : Show Sequence
    >gi|15676917|ref|NP_274064.1| hypothetical protein NMB1030 [Neisseria meningitidis MC58]
    MKKIIFAALAAAAISTASAATYKVDEYHANARFAIDHFNTSTNVGGFYGLTGSVEFDQAKRDGKIDITIP
    IANLQSGSQHFTDHLKSADIFDAAQYPDIRFVSTKFNFNGKKLVSVDGNLTMHGKTAPVKLKAEKFNCYQ
    SPMEKTEVCGGDFSTTIDRTKWGMDYLVNVGMTKSVRIDIQIEAAKQ
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protective antigen as shown in some assays (Giuliani et al., 2006)
3. GNA1162
  • Gene Name : GNA1162
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0010976
  • NCBI Gene ID : 903582
  • NCBI Protein GI : 15677037
  • Locus Tag : NMB1162
  • Genbank Accession : AE002098
  • Protein Accession : NP_274189
  • Taxonomy ID : 122586
  • Gene Starting Position : 1167697
  • Gene Ending Position : 1168344
  • Gene Strand (Orientation) : -
  • Protein Name : hypothetical protein
  • Protein pI : 6.26
  • Protein Weight : 20946.7
  • Protein Length : 215
  • DNA Sequence : Show Sequence
    >gi|77358697:1167697-1168344 Neisseria meningitidis MC58, complete genome
    CTTATTTGGGCTGCTCTTCAACGAATCTCGGACCTTTCAAGATGCCGTTGTGAGAATAGGGCGACAGCAG
    GTTGTATGCGGCGGTTTTGGAAACCTGATAACCGCGGTCGGTCAGGCTGTTGGCAATCTGATTGACCACT
    GCGCTGACCAAAGCCCCCAACAGGCCGCTGTTGCTGTTGTTGCTGCCTTCGCGGATGCTGGCCGAACCCG
    ACCACAACTCTTTTCCGTTGCGGGAATCGACCAGCCGTGCTTTGGCGGATACGGTCGTCACGCTGTCTAA
    AATTTGATATGAAGTGCCGTATTCGGTAACCGTAATGTACAAAACCGCATCATTGCCGAAAATCTGATGC
    AGTTTTTCCGGCCGGACGGCGTGAATATCGGCGGCATTGGTCAAGCCGTTTTGTTTGAAGGTTTCCTCCA
    CGACTGCGGCGGGGAAGACGTAATAGCCGGCTTCGGAAAGCGGCGCGGCGGTCGAAGCCAGTACACCCCA
    TGTTCCGTTGACATCGGGCGATTCGTTCAGCGGCGGAACCACCAAAATTGAAGCCGGTTTGCTTTCCTTG
    AATGACGTGTAGTCGAAATCGGGCGCTTTTTGAACTTGGCAGGCAGACAGCGCCAACACGGCGGCAAGCC
    CTAAAATCAAAGGTTTCA
  • Protein Sequence : Show Sequence
    >gi|15677037|ref|NP_274189.1| hypothetical protein NMB1162 [Neisseria meningitidis MC58]
    MKPLILGLAAVLALSACQVQKAPDFDYTSFKESKPASILVVPPLNESPDVNGTWGVLASTAAPLSEAGYY
    VFPAAVVEETFKQNGLTNAADIHAVRPEKLHQIFGNDAVLYITVTEYGTSYQILDSVTTVSAKARLVDSR
    NGKELWSGSASIREGSNNSNSGLLGALVSAVVNQIANSLTDRGYQVSKTAAYNLLSPYSHNGILKGPRFV
    EEQPK
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protective antigen(Pizza et al., 2000)
4. GNA1220
  • Gene Name : GNA1220
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0010975
  • NCBI Gene ID : 903642
  • NCBI Protein GI : 15677093
  • Locus Tag : NMB1220
  • Genbank Accession : NC_003112
  • Protein Accession : NP_274245
  • Taxonomy ID : 122586
  • Gene Starting Position : 1224371
  • Gene Ending Position : 1225318
  • Gene Strand (Orientation) : -
  • Protein Name : stomatin/Mec-2 family protein
  • Protein pI : 5.52
  • Protein Weight : 32124.16
  • Protein Length : 315
  • Protein Note : identified by similarity to GP:2984585; match to protein family HMM PF01145
  • DNA Sequence : Show Sequence
    >gi|903642|gb|U29414.1|HIV1U29414 Human immunodeficiency virus type 1 gag gene, clone 4-7, partial cds
    ATGGGTGCGAGAGCGTCAGTATTAAGCGGGGGAGAATTAGATAGATGGGAAAAAATTCGGTTAAGGCCAG
    AGGGAAAAAAAAGATATAAATTAAAACATATAGTATGGGCAAGCAGGGAGCTAGAACGATTCGCAGTTAA
    CCCTGGCCTGTTAAAAACATCAGAAGGCTGTAGACAGATACTGGTACAGCTACAACCATCCCTTCAGACA
    GGATCAGAAGAACTTAGATCATTATATAATACAGTAGCAACCCTCTATTGTGTGCATCAAAGAATAGAGG
    TAAAAGACACCAAGGAAGCTTTAGAGAAGATAGAGGAAGAGCAAAACAAAAGTAAGAAAAAAGCACAGCA
    AGCAGCAGCTGGCACAGGAAACAGCAGCCAGGTCAGCCAAAATTACCCTATAGTGCAGAACATCCAGGGG
    CAAATGGTACATCAGCCCCTATCACCTAGAACTTTAAATGCATGGGTAAAAGTAGTAGGAGAGAAGGCTT
    TCAGCCCAGAAGTAATACCCATGTTTTCAGCACTATCAGAAGGAGCCACCCCACAAGATTTAAACACCAT
    GTTAAACACAGTGGGGGGACATCAAGCAGCCATGCAAATGTTAAAAGAGACCATCAATGAGGAAGCTGCA
    GATTGGGATAGATTGCATCCAGTGCATGCAGGGCCTGTTGCACCAGGCCAGATGAGAGAACCAAGGGGAA
    GTGACATAGCAGGAACTACTAGTACCCTTCAGGAACAAATAGGATGGATGACAAATAATCCACCTATCCC
    AGTAGGAGAAATCTATAAAAGATGGATAATCCTGGGATTAAATAAAATAGTAAGGATGTATAGTCCTGCC
    AGCATTTTGGACATAAGACAAGGACCAAAGGAACCCTTTAGAGACTATGTAGACCGGTTCTATAAAACTC
    TAAGAGCCGAGCAAGCTTCACAGGAGGTAAAAAATAGGATGACAGAAACCTTGTTGGTCCAAAATGCAAA
    CCCAGATTGTAAGACTATTTTAAAAGCATTAGGACCGGGAGCTACACTAGAAGAAATGATGACAGCATGT
    CAGGGAGTAGGAGGACCCGGCCATAAAGCAAGAGTCTTGGCTGAAGCAATGAGCCAAGTAACAAATTCAG
    CTACCATAATGATGCAGAGAGGCAATTTTAGGAACCAAAGAAAGATTGTTAAGTGTTTCAATTGTGGCAA
    AGAGGGGCACATAGCCAGAAACTGCAGGGCCCCTAGGAAAAAGGGCTGTTGGAAATGTGGAAAGGAAGGA
    CACCAAATGAAAGATTGTACTGAGAGACAGGCTAATTTTTTAGGGAAGATCTGGCCTTCCCACAAGGGGA
    GGCCAGGGAATTTTCTTCAGAGCAGACCAGAGCCATCAGCCCCACCAGAAGAGAGCTTCAGGTTTGGGGA
    AGAGGCAACAACTTCCCCTCAGAAGCAGGAGCTGATAGACAAGGAGCTATATCCTTTAACCTCCCTCAGA
    TCACTCTTTGGCAACGACCCCTTGTCACAG
  • Protein Sequence : Show Sequence
    >gi|15677093|ref|NP_274245.1| stomatin/Mec-2 family protein [Neisseria meningitidis MC58]
    MEFFIILLVAVAVFGFKSFVVIPQQEVHVVERLGRFHRALTAGLNILIPFIDRVAYRHSLKEIPLDVPSQ
    VCITRDNTQLTVDGIIYFQVTDPKLASYGSSNYIMAITQLAQTTLRSVIGRMELDKTFEERDEINSTVVA
    ALDEAAGAWGVKVLRYEIKDLVPPQEILRSMQAQITAEREKRARIAESEGRKIEQINLASGQREAEIQQS
    EGEAQAAVNASNAEKIARINRAKGEAESLRLVAEANAEAIRQIAAALQTQGGADAVNLKIAEQYVAAFNN
    LAKESNTLIMPANVADIGSLISAGMKIIDSSKTAK
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protective antigen (Pizza et al., 2000)
5. GNA1870
  • Gene Name : GNA1870
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0010981
  • NCBI Gene ID : 904318
  • NCBI Protein GI : 15677705
  • Locus Tag : NMB1870
  • Genbank Accession : AE002098
  • Protein Accession : NP_274866
  • 3D structure: PDB ID : 1YS5
  • Taxonomy ID : 122586
  • Gene Starting Position : 1975217
  • Gene Ending Position : 1976179
  • Gene Strand (Orientation) : +
  • Protein Name : hypothetical protein
  • Protein pI : 9.11
  • Protein Weight : 32796.64
  • Protein Length : 320
  • Protein Note : also named factor H-binding protein (fHbp) or rLP-2086 (Pizza et al., 2008).
  • DNA Sequence : Show Sequence
    >gi|77358697:1975217-1976179 Neisseria meningitidis MC58, complete genome
    AATGCCGTCTGAACCGCCGTTCGGACGACATTTGATTTTTGCTTCTTTGACCTGCCTCATTGATGCGGTA
    TGCAAAAAAAGATACCATAACCAAAATGTTTATATATTATCTATTCTGCGTATGACTAGGAGTAAACCTG
    TGAATCGAACTGCCTTCTGCTGCCTTTCTCTGACCACTGCCCTGATTCTGACCGCCTGCAGCAGCGGAGG
    GGGTGGTGTCGCCGCCGACATCGGTGCGGGGCTTGCCGATGCACTAACCGCACCGCTCGACCATAAAGAC
    AAAGGTTTGCAGTCTTTGACGCTGGATCAGTCCGTCAGGAAAAACGAGAAACTGAAGCTGGCGGCACAAG
    GTGCGGAAAAAACTTATGGAAACGGTGACAGCCTCAATACGGGCAAATTGAAGAACGACAAGGTCAGCCG
    TTTCGACTTTATCCGCCAAATCGAAGTGGACGGGCAGCTCATTACCTTGGAGAGTGGAGAGTTCCAAGTA
    TACAAACAAAGCCATTCCGCCTTAACCGCCTTTCAGACCGAGCAAATACAAGATTCGGAGCATTCCGGGA
    AGATGGTTGCGAAACGCCAGTTCAGAATCGGCGACATAGCGGGCGAACATACATCTTTTGACAAGCTTCC
    CGAAGGCGGCAGGGCGACATATCGCGGGACGGCGTTCGGTTCAGACGATGCCGGCGGAAAACTGACCTAC
    ACCATAGATTTCGCCGCCAAGCAGGGAAACGGCAAAATCGAACATTTGAAATCGCCAGAACTCAATGTCG
    ACCTGGCCGCCGCCGATATCAAGCCGGATGGAAAACGCCATGCCGTCATCAGCGGTTCCGTCCTTTACAA
    CCAAGCCGAGAAAGGCAGTTACTCCCTCGGTATCTTTGGCGGAAAAGCCCAGGAAGTTGCCGGCAGCGCG
    GAAGTGAAAACCGTAAACGGCATACGCCATATCGGCCTTGCCGCCAAGCAATA
  • Protein Sequence : Show Sequence
    >gi|15677705|ref|NP_274866.1| hypothetical protein NMB1870 [Neisseria meningitidis MC58]
    MPSEPPFGRHLIFASLTCLIDAVCKKRYHNQNVYILSILRMTRSKPVNRTAFCCLSLTTALILTACSSGG
    GGVAADIGAGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSR
    FDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLP
    EGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYN
    QAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protective antigen (Giuliani et al., 2006)
6. GNA1946
  • Gene Name : GNA1946
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0010974
  • NCBI Gene ID : 904205
  • NCBI Protein GI : 15677776
  • Locus Tag : NMB1946
  • Genbank Accession : AE002098
  • Protein Accession : NP_274940
  • 3D structure: PDB ID : 3GXA
  • Taxonomy ID : 122586
  • Gene Starting Position : 2041081
  • Gene Ending Position : 2041944
  • Gene Strand (Orientation) : -
  • Protein Name : outer membrane lipoprotein
  • Protein pI : 4.96
  • Protein Weight : 29236.71
  • Protein Length : 287
  • Protein Note : identified by similarity to EGAD:30554; match to protein family HMM PF03180
  • DNA Sequence : Show Sequence
    >gi|77358697:2041081-2041944 Neisseria meningitidis MC58, complete genome
    CTTATTTGGCTGCGCCTTCATTCCATGCGGCAGGGGATTTGTAGCCCTCGAAGCGTTTGTGCGCGTAGGC
    TTTGAACGCGTCGGAGTTATAGGCCTCGGTTACGTCTTTAAGCCATTGGCTGTCTTTGTCGGCGGTTTTG
    ACGGCAGACCAGTTGACATAGGCAAAGCTCGGTTCTTGGAACAGGGCTTCGGTCAGCTTCATGCCGCTGC
    TTATGGCGTAGTTGCCGTTGACGACGGCAAAATCCACGTCGGCGCGGCTACGCGGCAGTTGCGCGGCTTC
    AAGCTCGACGATTTTGATGTTTTTCAGGTTCTCGGCGATGTCCGCTTTGGATGCGGTCAACGGATTGATG
    CCGTCTTTGAGTTTGATCCAACCCAGTTCGTCGAGCATCACCAAGACGCGGGCGAAGTTGGACGGGTCGT
    TGGGCGCGGATACGGTGCTGCCGTCTTTGACTTCTTCCAGCGATTTCAGCTTGCCCGGGTACAGTCCCAA
    AGGCGCGGTCGGCACTTGGAAGACTTCGGTGATGTCCAGATTGTGTTCTTTTTTGAAGTCGTCAAGATAG
    GGTTTGTGTTGGAAGACGTTGATGTCCAACTCGCCCTCAGCCAATGCCAGATTCGGGCGTACATAGTCGG
    TAAACTCGACCAGTTTGACGGTGTAGCCTTTTTTCTCCAGCTCGGCTTGGATTTGTTCTTTGACCATATC
    GCCGAAGTCGCCGACGGTCGTGCCGAAGACGATTTCTTTTTTCGCCGCGCCGTTGTCGGCGGCGGCAGAA
    GCGGATGCGGCGGGCGCGCTGTCTTTTTGACCGCCGCAGGCGGCGAGGATGAGCGCGAGTGCGGCGGCGG
    AAAGGGTTTTGAAGAAGGTTTTCA
  • Protein Sequence : Show Sequence
    >gi|15677776|ref|NP_274940.1| outer membrane lipoprotein [Neisseria meningitidis MC58]
    MKTFFKTLSAAALALILAACGGQKDSAPAASASAAADNGAAKKEIVFGTTVGDFGDMVKEQIQAELEKKG
    YTVKLVEFTDYVRPNLALAEGELDINVFQHKPYLDDFKKEHNLDITEVFQVPTAPLGLYPGKLKSLEEVK
    DGSTVSAPNDPSNFARVLVMLDELGWIKLKDGINPLTASKADIAENLKNIKIVELEAAQLPRSRADVDFA
    VVNGNYAISSGMKLTEALFQEPSFAYVNWSAVKTADKDSQWLKDVTEAYNSDAFKAYAHKRFEGYKSPAA
    WNEGAAK
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protective antigen (Pizza et al., 2000)
7. GNA2001
  • Gene Name : GNA2001
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0010947
  • NCBI Gene ID : 904124
  • NCBI Protein GI : 15677829
  • Locus Tag : NMB2001
  • Genbank Accession : NC_003112
  • Protein Accession : NP_274993
  • Taxonomy ID : 122586
  • Gene Starting Position : 2114380
  • Gene Ending Position : 2115135
  • Gene Strand (Orientation) : +
  • Protein Name : hypothetical protein
  • Protein pI : 10.78
  • Protein Weight : 26229.95
  • Protein Length : 251
  • Protein Note : identified by similarity to EGAD:91561; match to protein family HMM PF00877
  • DNA Sequence : Show Sequence
    >gi|904124|gb|L37919.1|LRZRBCL Lardizabala biternata ribulose-1,5-bisphosphate carboxylase large subunit gene, 3' end of cds
    NTGTCACCACAAACAGAGACTAAAGCAAGTGTTGGATTCAAAGCTGGTGTTAAAGATTACAAATTGACTT
    ATTATACTCCTGACTATATCACCAAAGATACTGATATCTTGGCAGCATTCCGAGTAACTCCTCAACCTGG
    AGTTCCACCTGAAGAAGCAGGGGCCGCGGTAGCTGCCGAATCTTCTACAGGTACATGGACAACTGTGTGG
    ACCGATGGACTTACCAGCCTTGATCGTTACAAAGGACGATGCTACGATATCGAGCCTGTTGCTGGAGAGG
    AGAACCAATATATTTGTTATGTAGCTTACCCTTTAGACCTTTTTGAAGAAGGTTCGGTTACTAACATGTT
    TACTTCCATTGTGGGTAATGTATTTGGGTTCAAAGCGCTACGCGCTCTACGTCTGGAAGATCTGCGAATC
    CCTCCTGCTTATGTTAAAACTTTCCAAGGCCCGCCTCATGGCATCCAAGTTGAGAGAGATAAATTGAACA
    AGTATGGTCGTCCCCTATTGGGCTGTACTATTAAACCAAAATTGGGATTATCTGCTAAGAACTACGGTAG
    AGCGGTTTATGAATGTCTCCGTGGTGGACTGGATTTTACCAAGGATGATGAAAACGTGAACTCCCAGCCA
    TTTATGCGTTGGAGAGACCGTTTCCTATTTTGTGCCGAAGCAATTTATAAAGCACAGGCCGAAACAGGTG
    AAATCAAAGGACATTACTTGAATGCTACTGCAGGTACATGCGAAGAAATGATCAAAAGAGCTGTATTTGC
    CAGAGAATTGGGAGTTCCTATCGTAATGCATGACTACTTAACGGGGGGATTCACTGCAAATACTAGCTTG
    GCTCATTATTGCCGAGATAATGGTCTACTTCTTCACATCCACCGTGCAATGCATGCAGTTATTGATAGAC
    AGAAGAATCATGGTATCCATTTCCGTGTACTAGCTAAAGCGTTACGTATGTCTGGGGGAGATCATATTCA
    CTCTGGTACCGTAGTAGGTAAACTGGAAGGGGAAAGAGAAATCACCTTGGGCTTTGTTGATTTACTACGT
    GATGATTTTATTGAAAAAGACCGAAGTCGCGGTATTTATTTCCTGCAAGATTGGGTCTCTCTACCAGGTG
    TTTTGCCCGTGGCTTCAGGGGGTATTCACGTTTGGCATATGCCTGCTCTGACCGAGATCTTTGGGGATGA
    CTCCGTACTACAGTTCGGTGGAGGAACTTTAGGACACCCTTGGGGAAATGCACCGGGTGCCGTAGCTAAT
    CGAGTAGCCCTAGAAGCGTGTGTACAAGCTCGTAATGAGGGACGTGATCTTGCTCGTGAAGGTAATGAAA
    TTATCCGTGAGGCTAGCAAATGGAGCCCTGAACTAGCTGCTGCTTGTGAAGTATGGAAGGAGATCAAATT
    CGAATTTGAAGCAATGGATACTTTGTAA
  • Protein Sequence : Show Sequence
    >gi|15677829|ref|NP_274993.1| hypothetical protein NMB2001 [Neisseria meningitidis MC58]
    MDSFFKPAVWAVLWLMFAVRPALADELTNLLSSREQILRQFAEDEQPVLPINRAPARRAGNADELIGSAM
    GLNEQPVLPVNRVPARRAGNADELIGNAMGLNEQPVLPVNRAPARRAGNADELIGNAMGLLGIAYRYGGT
    SVSTGFDCSGFMQHIFKRAMGINLPRTSAEQARMGTPVARSELQPGDMVFFRTLGGSRISHVGLYIGNNR
    FIHAPRTGKNIEITSLSHKYWSGKYAFARRVKKNDPSRFLN
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protective antigen (Pizza et al., 2000)
8. GNA2091
  • Gene Name : GNA2091
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0010982
  • NCBI Gene ID : 903958
  • NCBI Protein GI : 15677911
  • Locus Tag : NMB2091
  • Genbank Accession : AE002098
  • Protein Accession : NP_275079
  • Taxonomy ID : 122586
  • Gene Starting Position : 2211862
  • Gene Ending Position : 2212470
  • Gene Strand (Orientation) : +
  • Protein Name : putative hemolysin
  • Protein pI : 10.22
  • Protein Weight : 19563.68
  • Protein Length : 202
  • Protein Note : identified by similarity to EGAD:28637; match to protein family HMM PF04972
  • DNA Sequence : Show Sequence
    >gi|77358697:2211862-2212470 Neisseria meningitidis MC58, complete genome
    GATGAAACCCAAACCGCACACCGTCCGCACCCTGATTGCCGCCATTTTCAGCCTTGCCCTTAGCGGCTGC
    GTCAGCGCAGTAATCGGAAGCGCCGCCGTCGGCGCGAAATCCGCCGTCGACCGCCGAACCACCGGCGCGC
    AAACCGACGACAACGTTATGGCGTTGCGTATCGAAACCACCGCCCGTTCCTATCTGCGCCAAAACAACCA
    AACCAAAGGCTACACGCCCCAAATCTCCGTCGTCGGCTACAACCGCCACCTGCTGCTGCTCGGACAAGTC
    GCCACCGAAGGCGAAAAACAGTTCGTCGGTCAGATTGCACGTTCCGAACAGGCCGCCGAAGGCGTGTACA
    ACTATATTACCGTCGCCTCCCTGCCGCGCACTGCCGGCGACATCGCCGGCGACACTTGGAACACATCCAA
    AGTCCGCGCCACGCTGTTGGGCATCAGCCCCGCCACACAGGCGCGCGTCAAAATCGTTACCTACGGCAAC
    GTAACCTACGTTATGGGCATCCTCACCCCCGAAGAACAGGCGCAGATTACCCAAAAAGTCAGCACCACCG
    TCGGCGTACAAAAAGTCATCACCCTCTACCAAAACTACGTCCAACGCTG
  • Protein Sequence : Show Sequence
    >gi|15677911|ref|NP_275079.1| putative hemolysin [Neisseria meningitidis MC58]
    MKPKPHTVRTLIAAIFSLALSGCVSAVIGSAAVGAKSAVDRRTTGAQTDDNVMALRIETTARSYLRQNNQ
    TKGYTPQISVVGYNRHLLLLGQVATEGEKQFVGQIARSEQAAEGVYNYITVASLPRTAGDIAGDTWNTSK
    VRATLLGISPATQARVKIVTYGNVTYVMGILTPEEQAQITQKVSTTVGVQKVITLYQNYVQR
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protective antigen as shown in some assays (Giuliani et al., 2006)
9. GNA2132
  • Gene Name : GNA2132
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0010946
  • NCBI Gene ID : 903357
  • NCBI Protein GI : 15677945
  • Locus Tag : NMB2132
  • Genbank Accession : AE002098
  • Protein Accession : NP_275117
  • Taxonomy ID : 122586
  • Gene Starting Position : 2238475
  • Gene Ending Position : 2239941
  • Gene Strand (Orientation) : -
  • Protein Name : transferrin-binding protein-related protein
  • Protein pI : 4.57
  • Protein Weight : 48171.55
  • Protein Length : 488
  • Protein Note : identified by similarity to EGAD:39989; match to protein family HMM PF01298
  • DNA Sequence : Show Sequence
    >gi|77358697:2238475-2239941 Neisseria meningitidis MC58, complete genome
    ATCAATCCTGCTCTTTTTTGCCGGCAAACACGCCGAATCCGCCCTTTTCCGCATCTGTCGGGCGATAGCT
    GTATTTTCCCGCCACTTCCTCGCCGGCCGGGCCGTAAAACTTTCCGGAAACATCCCCGCTGCCATTTTCC
    GTCCAAGTCCCCTTAAAGCCGTTTCCATCGATGGCGGCTTTGAATTTTTGCGTACCCATATGCAAATCAT
    CGCCGCTGTCGATAATGCCGTCCACAGATTTGCTGCCGAAATCGACTTTTGCGGCAAACCTGCCCCTGGT
    CGGGTACGGACGGCCGTTTTCCGTATGGAAATGCAGTACTTCGCCGTTGTACACGGCCGCGCCCGCAAGC
    ATTTCGCCTTTTGCCGGTTCGCCTTGAACACGAAGGGCATACGATCCGCCGGGCAATTTTTCCGCCCCGT
    AAGTCAGATACCGGTAATTCCCTTCGGGCGCGAAGATATTGCCGGAATGCCCCGTCAGGCTGACCGCTTC
    CCCATCGACAATCAGCGTATCCGCCTGATTGACGGGAATCAGCGGCATCTCGGCCGGAAGCGACCGCCTC
    GACCGTGCAGAACGCCTAAATCGCGCAAATGAAGTGGGTTTAGGTTTATAAAAGATAATATATTGATTGA
    TTCCCTTCATCTGCACACTATCGGCAACCAAACCGACAAATTTATCATTCTTCCCATCTTTCTTGTAATT
    ACTTATTTTGTCTGCATCACTTAATTTTTCAAATTCTGATTTTAGCTGTACTTCTTCATCCAAGAAATTA
    TTGCCACTACAAGAATCGCCTTTACAGTGGGTCAACGTTATATTTTGCGACGGCCCGTCAATCAAAACGC
    CATTAGCCAAATCAACCCTTCCAAAATTGCTACCGCCATTCGCAGGTGCAGGGTTTGACGCGGGGATGGG
    ATCTGAAGAACCGGCGGCTTGATTGTTTCCGGCTTGATTTGCACCTTGGGCAGCCGTATTGCCGGCATTT
    TGCCCGCCTGCCGACGGATCGTCCCCCTGCATTCCGTCCGCCGCATTTGCCATATCCGGTTGGTTTGCCG
    GCTGAGACGATTCCCCGGCATCCGTTGCTTGATTTTCCATATTTCCGGCAAGCATATTCGGATCCGGGGT
    GTGATTCGGTGTCGAACTATCTGTACCGGCGGCATTTTGCGGCATATCATTTTGTGCCACCTCGTCTTCA
    TTTTTGGGATTATCCGCTGTTACCGCACCGCCATTGCCTGTATTTTCTTCCGAAACCGCCGCCATATCTT
    GACTGCCTTGTGCGGATGGCGCGCCCTGTCCTTGAGAACCTGCCTGTGGCGCATCTTCCTTTGCCTCTGT
    CTCTTTTTCAGAAACAACAGGGGCGGCAGGTTTTGACAGCGTGTCCGCCGACTTGACATCGGGCGATCCG
    CCACCGCCGCCCCCGCAGGCTGAAAGGGCAAAAATACAAGCCATTGCGATTACGCTGCGTTTAAACA
  • Protein Sequence : Show Sequence
    >gi|15677945|ref|NP_275117.1| transferrin-binding protein-related protein [Neisseria meningitidis MC58]
    MFKRSVIAMACIFALSACGGGGGGSPDVKSADTLSKPAAPVVSEKETEAKEDAPQAGSQGQGAPSAQGSQ
    DMAAVSEENTGNGGAVTADNPKNEDEVAQNDMPQNAAGTDSSTPNHTPDPNMLAGNMENQATDAGESSQP
    ANQPDMANAADGMQGDDPSAGGQNAGNTAAQGANQAGNNQAAGSSDPIPASNPAPANGGSNFGRVDLANG
    VLIDGPSQNITLTHCKGDSCSGNNFLDEEVQLKSEFEKLSDADKISNYKKDGKNDKFVGLVADSVQMKGI
    NQYIIFYKPKPTSFARFRRSARSRRSLPAEMPLIPVNQADTLIVDGEAVSLTGHSGNIFAPEGNYRYLTY
    GAEKLPGGSYALRVQGEPAKGEMLAGAAVYNGEVLHFHTENGRPYPTRGRFAAKVDFGSKSVDGIIDSGD
    DLHMGTQKFKAAIDGNGFKGTWTENGSGDVSGKFYGPAGEEVAGKYSYRPTDAEKGGFGVFAGKKEQD
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protective antigen (Pizza et al., 2000).
10. GNA33
  • Gene Name : GNA33
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0010978
  • NCBI Gene ID : 902136
  • NCBI Protein GI : 15675973
  • Locus Tag : NMB0033
  • Genbank Accession : NC_003112
  • Protein Accession : NP_273099
  • Taxonomy ID : 122586
  • Gene Starting Position : 30910
  • Gene Ending Position : 32235
  • Gene Strand (Orientation) : -
  • Protein Name : putative membrane-bound lytic murein transglycosylase A
  • Protein pI : 10.02
  • Protein Weight : 45724.72
  • Protein Length : 441
  • Protein Note : identified by similarity to GP:974447; match to protein family HMM PF03562; match to protein family HMM PF06725
  • DNA Sequence : Show Sequence
    >gi|902136|gb|H30980.1|H30980 SW3ICA229SK Brugia malayi infective larva cDNA (SAW94WL-BmL3) Brugia malayi cDNA clone SW3ICA229 5' similar to Filarial Ag Av 33 and Oncho immunodominant Ag, mRNA sequence
    GTTNGAGATCGTGATTATATAATCCAGCAACAAGTCTGACTTCAAAGATAACTATGAAGACTCTTTTTTG
    TTTGTTATTATTCGCGATAGCAGTGCTGGAAGCAGGTATAGTGAAAAGGTATAACAAACGCTTCGCTGGA
    TTCAACGTTGCAGGAATTGGTGGAACAGCCGGATGTGTGGTCGTTGACAACAAACTGTTTGGGAATGGTT
    TACCTCTTCGAGAATTGGCCGCCGAAGGACAAAAAGGAATTATCACGATATGTCCAAGAGTCAAATNAAT
    ACAAAGGGGGTTTGGTGACGTCA
  • Protein Sequence : Show Sequence
    >gi|15675973|ref|NP_273099.1| putative membrane-bound lytic murein transglycosylase A [Neisseria meningitidis MC58]
    MKKYLFRAALYGIAAAILAACQSKSIQTFPQPDTSVINGPDRPVGIPDPAGTTVGGGGAVYTVVPHLSLP
    HWAAQDFAKSLQSFRLGCANLKNRQGWQDVCAQAFQTPVHSFQAKQFFERYFTPWQVAGNGSLAGTVTGY
    YEPVLKGDDRRTAQARFPIYGIPDDFISVPLPAGLRSGKALVRIRQTGKNSGTIDNTGGTHTADLSRFPI
    TARTTAIKGRFEGSRFLPYHTRNQINGGALDGKAPILGYAEDPVELFFMHIQGSGRLKTPSGKYIRIGYA
    DKNEHPYVSIGRYMADKGYLKLGQTSMQGIKSYMRQNPQRLAEVLGQNPSYIFFRELAGSSNDGPVGALG
    TPLMGEYAGAVDRHYITLGAPLFVATAHPVTRKALNRLIMAQDTGSAIKGAVRVDYFWGYGDEAGELAGK
    QKTTGYVWQLLPNGMKPEYRP
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protective antigen (Pizza et al., 2000)
11. GNA992 (hsf)
  • Gene Name : GNA992 (hsf)
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0010977
  • NCBI Gene ID : 903112
  • NCBI Protein GI : 15676883
  • Locus Tag : NMB0992
  • Genbank Accession : AE002098
  • Protein Accession : NP_274028
  • Taxonomy ID : 122586
  • Gene Starting Position : 1005588
  • Gene Ending Position : 1007363
  • Gene Strand (Orientation) : -
  • Protein Name : adhesin
  • Protein pI : 5.98
  • Protein Weight : 56655.27
  • Protein Length : 591
  • Protein Note : identified by similarity to EGAD:131908; match to protein family HMM PF03895; match to protein family HMM PF05662
  • Protein Annotation : hsf or called GNA992
  • DNA Sequence : Show Sequence
    >gi|77358697:1005588-1007363 Neisseria meningitidis MC58, complete genome
    CTTACCACTGATAACCGACAGATGCGGAAGCACCGAAATGGCCGCGCGAATTGCCGGAAGCCGTGCCTTT
    GATAATCCAATTTCCGCCGTCGGAAATACTGGAGTAGCCGATGGCGTAACCGGCTTCGCCGCGATAAGTG
    CCGCCGCCGATCGCCATCATACTCTTGCCGGGCAAATACGCCTGAACCAGACCTGCGGTTGCAATCGCTT
    GGGCGATGCCCGCACGCGCGTTGCCGTCCACATTGTCGATGCGGTTGTTCAAGTTTTGCGCCACGCCTTT
    AAGTTGTGCGACGTTTGTAACATCCCCCTCTTTAACGCCCGGGGCGACATTGGTAATGCGGACGGGTTTG
    TTGTCCTTCTTGCTGCCGACATTCAATGCGTCCCCATCCACGCTCAAAGTGGGCGCATCCGCCCCCGCGC
    CGAGCGAAACGCTGGAAAACTGCGGGGTCATCGAAGTGGCGATGTCGATATTTTTACCGTTGCGGGTAAT
    CTCGATGTTGTTGCCGGCATTAATGTTGACGGTTTCATCCATCTTTCCCTTGCTCGGCGAAACATTGCCG
    CTGATGACTTTGCCCGAAGAACCTGCAACCGCTTTGGAATCCAAATTCCAACCGCTGTTTTGCAGCTGAT
    TGACGTTTAGGGCATCGCCGACATTTACATCATACATAACAGTGATGTTGCCTTGATCATCTTTACTTAC
    AGTCGCAGTTGTACCTTTACCACTAGCAAAGGTTACATTTGTGCCTGATGTAACGGTTTCAAACTTGTCA
    GCTTGACCTGTTTGACCATTAGCGGTTGTTGTTTTCATTCTCCAACCAGCCTTGTTTACTGCATCAATCA
    CTTCTTTTGCAGTCACTAAGCCTTCGCCTTCGTCTGTAGAAGAACCATTCTCGCCTTTGTCTTTACCAGT
    AACCAACTTACCGTCTTTTTCTTTAATAACAGAAGTCTTCGCACCGATTTTAACTTCGGTTTTCTTGCCG
    TTGTCTTTGCTTTCCACATTAACAGTCGTTGTTTTCGTATCTGCGCTCAAGAACTCGACTGTGTCGTAAG
    TGCGGACGAAATCAACGTTATCGGAAGCTGTTGTACCGGGTTTAACGCCTTTAATGTTCCAGCCAGCGTT
    TAATACGTCTTTAACGCTTGCCGCACGTTTTTTCTCGTCATCGGTAACGTTGTCGTTGGTTACGTTTGTG
    GTCGCTCCGGTATTCAGCAGCGTATCGGTCAAAGTCGAACCAATACCGTTCAGATGAACCGTGGTGTCGC
    CGTTCGTCCCAGCCGTTTCTTTCGCAAAATTCAAGCCTTTGGTGTCGCTTGTGATGTTGACTTTATTGCC
    GTTTGCGCTAAACGATAATTTTTCAGTTCCAACACTGGTCAGATCTGTGAGGTCTTTTTTCAGCGAGTAG
    GTGAAGTTTGTGCCGTTTTGTTTGATTTTCAGGTTGTCGCCGGCTTTGAGGGTGATTTCTCTGGCTGTTA
    GTACTCCTTTCTCGTTGAAATATACTGCCCAATCTGAATTTTCTTCTACTTTTTCTTTTTCTCCCGTGCC
    TTCTTTATCGGAATTGACTATCAACACGGCAACAGTGCGTTGTACGGGGTCTAAATATAAATCTTCTTCT
    TGCTCTTCATTGTTAGCACTTGCCTGAACCGTTGCAAACAACAGTGTCGCCAATACGGCGGTCTTCACGG
    TTGCGGAGGCGCGTTTGGTGTGGTTGCGTGTGAGCTCGGATACGACGACCCAGGCATTGAGGGCACTATT
    CCAAATGATGCGGTATATTTTGTTCA
  • Protein Sequence : Show Sequence
    >gi|15676883|ref|NP_274028.1| adhesin [Neisseria meningitidis MC58]
    MNKIYRIIWNSALNAWVVVSELTRNHTKRASATVKTAVLATLLFATVQASANNEEQEEDLYLDPVQRTVA
    VLIVNSDKEGTGEKEKVEENSDWAVYFNEKGVLTAREITLKAGDNLKIKQNGTNFTYSLKKDLTDLTSVG
    TEKLSFSANGNKVNITSDTKGLNFAKETAGTNGDTTVHLNGIGSTLTDTLLNTGATTNVTNDNVTDDEKK
    RAASVKDVLNAGWNIKGVKPGTTASDNVDFVRTYDTVEFLSADTKTTTVNVESKDNGKKTEVKIGAKTSV
    IKEKDGKLVTGKDKGENGSSTDEGEGLVTAKEVIDAVNKAGWRMKTTTANGQTGQADKFETVTSGTNVTF
    ASGKGTTATVSKDDQGNITVMYDVNVGDALNVNQLQNSGWNLDSKAVAGSSGKVISGNVSPSKGKMDETV
    NINAGNNIEITRNGKNIDIATSMTPQFSSVSLGAGADAPTLSVDGDALNVGSKKDNKPVRITNVAPGVKE
    GDVTNVAQLKGVAQNLNNRIDNVDGNARAGIAQAIATAGLVQAYLPGKSMMAIGGGTYRGEAGYAIGYSS
    ISDGGNWIIKGTASGNSRGHFGASASVGYQW
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protective antigen (Pizza et al., 2000)
12. gp120
  • Gene Name : gp120
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1
  • NCBI Protein GI : 2326505
  • Other Database IDs : CDD:109567
    GOA:O40515
    InterPro: IPR000777
    UniProtKB/TrEMBL: O40515
  • Taxonomy ID : 11676
  • Gene Strand (Orientation) : ?
  • Protein Length : 109
  • Protein Note : Envelope glycoprotein GP120; pfam00516
  • Protein Sequence : Show Sequence
    >gi|2326505|emb|CAA74764.1| gp120 [Human immunodeficiency virus 1]
    NGSLAEGEVVIRSENFTDNAKTIIVQLNESVVINCTRPNNNTRKNIHLGRGRSVYATEKIIGNVKQAHCN
    ISRAKWNDTLKQIVEKLREQFGKNKTIVFNQSSGGDPEI
  • Molecule Role : Protective antigen
  • Related Vaccine(s): N. meningitidis DNA vaccine P3A
13. LctP
  • Gene Name : LctP
  • Sequence Strain (Species/Organism) : Neisseria meningitidis
  • VO ID : VO_0011185
  • NCBI Protein GI : 254667969
  • Other Database IDs : CDD:163899
    CDD:170425
  • Taxonomy ID : 662598
  • Gene Strand (Orientation) : ?
  • Protein Name : L-lactate permease
  • Protein Length : 528
  • Protein Note : L-lactate permease; cl00701
  • Protein Sequence : Show Sequence
    >gi|254667969|emb|CBA04244.1| L-lactate permease [Neisseria meningitidis]
    MALFLSIFPIVLLIWLMVKKNSMPSYVALPITAVLIYAIKLFYFGDAGMLLNATAASGLVKTLTPITVIF
    GAIMFNRMMETTGCIDVIRKWLATISPNPVAQLMIIGWAFAFMIEGASGFGTPAAIAAPILMSLGFNPLK
    VAIFTLVMNSVPVSFGAVGTPTWFGFAPLNLSAEDILAIGRQTGVMHFFAGFVIPVIGLGFIVPWSEIRK
    NLGFVAIAVFSCTIPYVALAMVNEEFPSLVAGAIGLMVSVFAANQGWGLSKDHAKDPNAEKVPFAQVAKA
    LAPLGMLIGMLVVTRIKQLGIKGILTSKEEWFSFQLPFDLSKITVSDSLTITFGNIFGQDVSASYQTLYV
    PAWIPFVLTVWICILLYKTKFKDAWTIYSVTFNQTKKPLLALMGALIMVQLMLVGGDNSMVKIIGKEFAA
    MAGEHWVYFSPYLGAIGAFFSGSNTVSNLTFGPIQQQIALDTGLSVTLILALQSVGGAMGNMVCLNNIIA
    VCTVLDVKNSEGAIIKKTVIPMAIYGVIAVVAAMIFFL
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : A total of 11 meningococcal proteins that are necessary for establishing systemic infection were expressed as recombinant antigens and assessed for their ability to protect mice against live bacterial challenge against N. meningitidis; the lactate permease (LctP) elicited protective immunity (Sun et al., 2005).
  • Related Vaccine(s): N. meningitidis LctP Protein Vaccine
14. LpdA
  • Gene Name : LpdA
  • Sequence Strain (Species/Organism) : Neisseria meningitidis
  • VO ID : VO_0011181
  • NCBI Protein GI : 1017430
  • Other Database IDs : CDD:133458
    CDD:176428
    CDD:168567
    CDD:145812
    GOA:Q51191
    HSSP: P06959
    InterPro: IPR000089
    InterPro: IPR000815
    InterPro: IPR001100
    InterPro: IPR001327
    InterPro: IPR003016
    InterPro: IPR004099
    InterPro: IPR006258
    InterPro: IPR011053
    InterPro: IPR012999
    InterPro: IPR013027
    UniProtKB/TrEMBL: Q51191
  • Taxonomy ID : 487
  • Gene Strand (Orientation) : ?
  • Protein Name : outer membrane protein P64k or PM-6
  • Protein Length : 593
  • Protein Note : Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid dehydrogenase multienzyme complexes, like pyruvate dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH) and branched-chain 2-oxo acid...; cd06849
  • Protein Sequence : Show Sequence
    >gi|1017430|emb|CAA57206.1| outer membrane protein P64k or PM-6 [Neisseria meningitidis]
    MALVELKVPDIGGHENVDIIAVEVNVGDTIAVDDTLITLETDKATMDIPAEVAGVVKEVKVKVGDKISEG
    GLIVVVEAEGAATAPKAEAPATPAQEAPKAAAPAPQAAQFGGSADAEYDVVLGGGPGGYSAAFAAADEGL
    KVAIVERYKTLGGVCLNVGCIPSKALLHNAAVIDEVRHLAANGIKYPEPELDIDMLRAYKNGVVSRLTGG
    LAGMAKRRKVDVIQGDGQFLDPHHLEVSLTAGDAYEQAAPTGEKKIVAFKNCIIAAGSRVTKLPFIPEDP
    RIIDSSGALALKEVPGKLLIIGAGIIGLEMGTVYSTLGSRLDVVEMMDGLMQGADRDLVKVWQKQNEYRF
    DNIMVNTKTVAVEPKEDGVYVTFEGANAPKEPQRYDAVLVAAGRAPNGKLISAEKAGVAVTDRGFIEVDK
    QMRTNVPHIYAIVDIVGQPMLAHKAVHEGHVAAENCAGHKAYFDARVIPGVAYTSPEVAWVGETELSAKA
    SGRKITKANFPWAASGRAIANGCDNGFTKLIFDAETGRIIGGGIVGPNGGDMIGEVCLAIEMGCDAADIG
    KTIHPHPTLGESIGMAAEVALGTCTDLPPQKKK
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Sera of the challenge group immunized with CCPS-P64kR showed a three-fold higher bactericidal response than the sera of the group immunized with the plain CCPS and they were able to protect against challenge with Neisseria meningococci in the infant rat protection model (Carmenate et al., 2004).
  • Related Vaccine(s): CCPS-P64kR
15. LPS
  • Gene Name : LPS
  • Sequence Strain (Species/Organism) : Neisseria meningitidis
  • Gene Strand (Orientation) : ?
  • Protein Name : lipopolysaccharide
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Seventeen monoclonal antibodies to one of three main cell surface antigens of Neisseria meningitidis group B were tested for protective efficacy in the infant rat using as challenge seven strains of different class 2/3 protein serotypes. Survival of the animals was regularly obtained with antibodies to the P1 protein and to LPS (Saukkonen et al., 1989).
16. metH
  • Gene Name : metH
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • NCBI Gene ID : 903064
  • NCBI Protein GI : 15676837
  • Locus Tag : NMB0944
  • Genbank Accession : AE002098
  • Protein Accession : NP_273982
  • Taxonomy ID : 122586
  • Gene Starting Position : 957284
  • Gene Ending Position : 959560
  • Gene Strand (Orientation) : +
  • Protein Name : 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase
  • Protein pI : 5.08
  • Protein Weight : 79718.7
  • Protein Length : 758
  • Protein Note : catalyzes the transfer of a methyl group from 5-methyltetrahydrofolate to homocysteine to form methionine
  • DNA Sequence : Show Sequence
    >gi|77358697:957284-959560 Neisseria meningitidis MC58, complete genome
    CATGACAACATTACATTTCTCAGGCTTCCCGCGTGTCGGCGCCTTCCGCGAATTGAAATTCGCACAAGAA
    AAATACTGGCGCAAAGAAATCAGCGAGCAAGAATTGCTGGCTGTTGCTAAAGACTTGCGCGAGAAAAACT
    GGAAACACCAGGTCGCTGCCAACGCCGATTTCGTTGCCGTAGGCGATTTCACTTTCTACGACCACATCCT
    CGACCTGCAAGTCGCCACCGGCGCGATTCCCGCCCGCTTCGGCTTCGACAGCCAAAACCTGTCTTTGGAA
    CAATTCTTCCAACTGGCGCGCGGTAACAAAGACCAATTCGCTATCGAAATGACCAAATGGTTCGACACCA
    ACTACCACTACTTGGTGCCTGAATTCCACGCCGATACCGAATTCAAAGCCAATGCCAAACACTATGTTCA
    ACAACTGCAAGAAGCCCAAGCCCTCGGTCTGAAAGCCAAACCGACCGTTGTAGGTCCGTTGACTTTCCTG
    TGGGTGGGTAAAGAAAAAGGCGCCGTCGAATTCGACCGTCTGAGCCTGTTGCCTAAACTGTTGCCTGTTT
    ACGTTGAAATCCTGACTGCTTTGGTTGAAGCCGGTGCCGAGTGGATTCAAATCGACGAGCCTGCTTTGGC
    TGTCGATTTGCCTAAAGAATGGGTGGAAGCCTACAAAGACGTTTACGCTACTTTGAGCAAAGTAAGTGCC
    AAAATCCTGTTGAGCACTTACTTCGGTTCTGTTGCCGAACACGCCGCATTGTTGAAAGCCCTGCCTGTTG
    ACGGTCTGCACATCGACTTGGTACGCGCCCCCGAGCAACTGGACGCGTTCGCCGACTACGACAAAGTCCT
    GTCTGCCGGCGTGATTGACGGCCGCAACATTTGGCGCGCCAACCTGAACAAAGTTTTGGAAACTGTCGAG
    CCTCTGCAAGCCAAACTGGGTGACCGTTTGTGGATTTCCAGCTCTTGCTCGCTGCTGCACACTCCATTTG
    ACTTGTCAGTTGAAGAAAAACTGAAAGCCAACAAACCCGACCTGTACTCTTGGTTGGCATTCACCCTGCA
    AAAAACCCAAGAATTGCGCGTTCTGAAAGCTGCATTGAACGAAGGCCGTGATTCTGTTGCCGAAGAACTC
    GCCGCCAGCCAAGCTGCTGCCGACTCCCGTGCCAACAGCAGCGAAATCCATCGTGCAGACGTTGCCAAAC
    GCCTGGCCGATTTGCCTGCCAACGCAGACCAACGCAAATCTCCATTTGCCGACCGTATCAAAGCGCAACA
    AGCATGGTTGAACCTACCTCTGCTACCGACTACCAACATCGGTTCTTTCCCGCAAACCACCGAAATCCGC
    CAGGCACGCTCAGCCTTCAAAAAAGGCGAACTGTCTGCCGCCGATTACGAAGCCGCGATGAAAAAAGAAA
    TCGCCTTGGTGGTTGAAGAGCAAGAAAAACTGGACTTGGACGTACTGGTACACGGCGAAGCCGAGCGTAA
    CGACATGGTTGAATACTTCGGCGAATTGTTGAGCGGTTTTGCATTCACTCAATACGGCTGGGTACAAAGC
    TACGGCTCACGCTGCGTGAAACCACCGATTATCTTTGGCGACGTAAGCCGTCCTGAAGCCATGACCGTGG
    CTTGGTCTACTTACGCACAAAGCCTGACCAAACGCCCGATGAAAGGTATGTTGACCGGCCCTGTAACCAT
    TCTGCAATGGTCTTTCGTCCGCAACGACATTCCTCGCTCTACCGTGTGCAAACAAATCGCACTGGCTCTG
    AACGACGAAGTATTGGATCTGGAAAAAGCCGGCATCAAAGTCATCCAAATTGACGAACCTGCCATCCGCG
    AAGGCTTGCCGCTGAAACGCGCCGATTGGGATGCCTACCTGAACTGGGCGGGCGAATCCTTCCGCCTGTC
    CTCTGCCGGTTGCGAAGACAGCACCCAAATCCACACTCATATGTGTTACTCCGAGTTCAACGATATCCTG
    CCTGCGATTGCTGCAATGGATGCGGACGTGATCACCATCGAGACTTCACGTTCCGACATGGAACTCTTGA
    CCGCGTTCGGCGAATTCCAATACCCGAACGACATCGGCCCGGGGGTTTACGACATCCACAGCCCGCGCGT
    ACCGACAGAAGCCGAAGTGGAGCACCTGTTGCGCAAAGCCATCGAGGTTGTACCGGTTGAACGTCTGTGG
    GTTAACCCGGACTGCGGCCTGAAAACACGCGGCTGGAAAGAAACTCTGGAACAACTCCAAGTAATGATGA
    ACGTAACCCGAAAACTGCGTGCCGAATTGGCGAAATA
  • Protein Sequence : Show Sequence
    >gi|15676837|ref|NP_273982.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [Neisseria meningitidis MC58]
    MTTLHFSGFPRVGAFRELKFAQEKYWRKEISEQELLAVAKDLREKNWKHQVAANADFVAVGDFTFYDHIL
    DLQVATGAIPARFGFDSQNLSLEQFFQLARGNKDQFAIEMTKWFDTNYHYLVPEFHADTEFKANAKHYVQ
    QLQEAQALGLKAKPTVVGPLTFLWVGKEKGAVEFDRLSLLPKLLPVYVEILTALVEAGAEWIQIDEPALA
    VDLPKEWVEAYKDVYATLSKVSAKILLSTYFGSVAEHAALLKALPVDGLHIDLVRAPEQLDAFADYDKVL
    SAGVIDGRNIWRANLNKVLETVEPLQAKLGDRLWISSSCSLLHTPFDLSVEEKLKANKPDLYSWLAFTLQ
    KTQELRVLKAALNEGRDSVAEELAASQAAADSRANSSEIHRADVAKRLADLPANADQRKSPFADRIKAQQ
    AWLNLPLLPTTNIGSFPQTTEIRQARSAFKKGELSAADYEAAMKKEIALVVEEQEKLDLDVLVHGEAERN
    DMVEYFGELLSGFAFTQYGWVQSYGSRCVKPPIIFGDVSRPEAMTVAWSTYAQSLTKRPMKGMLTGPVTI
    LQWSFVRNDIPRSTVCKQIALALNDEVLDLEKAGIKVIQIDEPAIREGLPLKRADWDAYLNWAGESFRLS
    SAGCEDSTQIHTHMCYSEFNDILPAIAAMDADVITIETSRSDMELLTAFGEFQYPNDIGPGVYDIHSPRV
    PTEAEVEHLLRKAIEVVPVERLWVNPDCGLKTRGWKETLEQLQVMMNVTRKLRAELAK
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A metH mutant, in combination with a siaD mutation, is attenuated in mice and induces significant protection from challenge with wild type N. meningitidis (Li et al., 2004).
  • Related Vaccine(s): Neisseria meningitidis metH/siaD mutant vaccine
17. NadA
  • Gene Name : NadA
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0010980
  • NCBI Gene ID : 904134
  • NCBI Protein GI : 15677822
  • Locus Tag : NMB1994
  • Genbank Accession : AE002098
  • Protein Accession : NP_274986
  • Taxonomy ID : 122586
  • Gene Starting Position : 2100382
  • Gene Ending Position : 2101476
  • Gene Strand (Orientation) : +
  • Protein Name : putative adhesin/invasin
  • Protein pI : 4.54
  • Protein Weight : 35292.78
  • Protein Length : 364
  • Protein Note : identified by similarity to GP:2735093; match to protein family HMM PF03895
  • DNA Sequence : Show Sequence
    >gi|77358697:2100382-2101476 Neisseria meningitidis MC58, complete genome
    AATGAGCATGAAACACTTTCCATCCAAAGTACTGACCACAGCCATCCTTGCCACTTTCTGTAGCGGCGCA
    CTGGCAGCCACAAGCGACGACGATGTTAAAAAAGCTGCCACTGTGGCCATTGTTGCTGCCTACAACAATG
    GCCAAGAAATCAACGGTTTCAAAGCTGGAGAGACCATCTACGACATTGGTGAAGACGGCACAATTACCCA
    AAAAGACGCAACTGCAGCCGATGTTGAAGCCGACGACTTTAAAGGTCTGGGTCTGAAAAAAGTCGTGACT
    AACCTGACCAAAACCGTCAATGAAAACAAACAAAACGTCGATGCCAAAGTAAAAGCTGCAGAATCTGAAA
    TAGAAAAGTTAACAACCAAGTTAGCAGACACTGATGCCGCTTTAGCAGATACTGATGCCGCTCTGGATGA
    AACCACCAACGCCTTGAATAAATTGGGAGAAAATATAACGACATTTGCTGAAGAGACTAAGACAAATATC
    GTAAAAATTGATGAAAAATTAGAAGCCGTGGCTGATACCGTCGACAAGCATGCCGAAGCATTCAACGATA
    TCGCCGATTCATTGGATGAAACCAACACTAAGGCAGACGAAGCCGTCAAAACCGCCAATGAAGCCAAACA
    GACGGCCGAAGAAACCAAACAAAACGTCGATGCCAAAGTAAAAGCTGCAGAAACTGCAGCAGGCAAAGCC
    GAAGCTGCCGCTGGCACAGCTAATACTGCAGCCGACAAGGCCGAAGCTGTCGCTGCAAAAGTTACCGACA
    TCAAAGCTGATATCGCTACGAACAAAGCTGATATTGCTAAAAACTCAGCACGCATCGACAGCTTGGACAA
    AAACGTAGCTAATCTGCGCAAAGAAACCCGCCAAGGCCTTGCAGAACAAGCCGCGCTCTCCGGCCTGTTC
    CAACCTTACAACGTGGGTCGGTTCAATGTAACGGCTGCAGTCGGCGGCTACAAATCCGAATCGGCAGTCG
    CCATCGGTACCGGCTTCCGCTTTACCGAAAACTTTGCCGCCAAAGCAGGCGTGGCAGTCGGCACTTCGTC
    CGGTTCTTCCGCAGCCTACCATGTCGGCGTCAATTACGAGTGGTA
  • Protein Sequence : Show Sequence
    >gi|15677822|ref|NP_274986.1| putative adhesin/invasin [Neisseria meningitidis MC58]
    MSMKHFPSKVLTTAILATFCSGALAATSDDDVKKAATVAIVAAYNNGQEINGFKAGETIYDIGEDGTITQ
    KDATAADVEADDFKGLGLKKVVTNLTKTVNENKQNVDAKVKAAESEIEKLTTKLADTDAALADTDAALDE
    TTNALNKLGENITTFAEETKTNIVKIDEKLEAVADTVDKHAEAFNDIADSLDETNTKADEAVKTANEAKQ
    TAEETKQNVDAKVKAAETAAGKAEAAAGTANTAADKAEAVAAKVTDIKADIATNKADIAKNSARIDSLDK
    NVANLRKETRQGLAEQAALSGLFQPYNVGRFNVTAAVGGYKSESAVAIGTGFRFTENFAAKAGVAVGTSS
    GSSAAYHVGVNYEW
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protective antigen (Giuliani et al., 2006; Comanducci et al., 2002). There is another nadA (quinolinate synthetase) [ Neisseria meningitidis MC58 ] with GeneID: 902509. However, according to sequence analysis, this nadA is not the same NadA that was found to be protective antigen (Giuliani et al., 2006; Comanducci et al., 2002).
18. NspA from N. meningitidis
  • Gene Name : NspA from N. meningitidis
  • Sequence Strain (Species/Organism) : Neisseria meningitidis
  • VO ID : VO_0011184
  • NCBI Protein GI : 5825543
  • 3D structure: PDB ID : 1P4T
  • Other Database IDs : CDD:174558
  • Taxonomy ID : 487
  • Gene Strand (Orientation) : ?
  • Protein Name : surface protein A
  • Protein Length : 174
  • Protein Note : Surface antigen; cl01155
  • Protein Sequence : Show Sequence
    >gi|5825543|gb|AAD53286.1|AF175683_1 surface protein A [Neisseria meningitidis]
    MKKALATLIALALPAAALAEGASGFYVQADAAHAKASSSLGSAKGFSPRISAGYRINDLRFAVDYTRYKN
    YKAPSTDFKLYSIGASAIYDFDTQSPVKPYLGARLSLNRASVDLGGSDSFSQTSIGLGVLTGVSYAVTPN
    VDLDAGYRYNYIGKVNTVKNVRSGELSVGVRVKF
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : NspA-containing outer membrane vesicles conferred protection against otherwise lethal intraperitoneal challenge of mice with N. meningitidis serogroup B, and sera raised against them mediated opsonophagocytosis of meningococcal strains expressing this antigen (O'dwyer et al., 2004).
19. NspA from N. meningitidis MC58
  • Gene Name : NspA from N. meningitidis MC58
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0010979
  • NCBI Gene ID : 902774
  • NCBI Protein GI : 15676561
  • Locus Tag : NMB0663
  • Genbank Accession : NC_003112
  • Protein Accession : NP_273705
  • 3D structure: PDB ID : 1P4T
  • Taxonomy ID : 122586
  • Gene Starting Position : 690297
  • Gene Ending Position : 690821
  • Gene Strand (Orientation) : -
  • Protein Name : outer membrane protein
  • Protein pI : 10.02
  • Protein Weight : 17106.9
  • Protein Length : 174
  • Protein Note : identified by similarity to EGAD:137514; match to protein family HMM PF02462
  • DNA Sequence : Show Sequence
    >gi|902774|gb|U20470.1|IAU20470 Influenza A virus (A/tern/Potsdam/342/6/79(H7N7)) hemagglutinin precursor (HA) mRNA, partial cds
    AGCAAAAGCAGGGGATACAAAATGAACACTCAAATCCTGATATTCGCTCTTGTGGCGATCATCCCAACAA
    ATGCAGACAAAATTTGCCTTGGGCATCATGCCGTGTCAAACGGAACTAAAGTAAACACACTAACTGAGAG
    AGGAATAGAAGTTGTCAATGCAACTGAAACAGTGGAGAGAGCAAACATCCCCAGGATCTGCTCAAAAGGG
    AAAAGGACAATCGACCTTGGCCAATGTGGACTGCTGGGAACAATCACTGGACCACCTCAATGTGACCAAT
    TCCTAGAATTCTCAGCTGATTTGATCATTGAAAGGCGGGAAGGAAATGATGTTTGTTATCCTGGAAAATT
    TGTAAACGAAGAAGCTCTGAGACAGATTCTCAGGGAATCAGGCGGAATTGATAAGGAAACAATGGGATTC
    ACATATAGCGGAATAAGAACCAATGGAGAAACCGGTGCATGTAGAAGATCAGGATCTTCATTCTATGCAG
    AGATGAAATGGCTTCTGTCAAATACAGACAATGCTGCTTTCCCACAGACAACGAAGTCGTACAAGAACAC
    AAGGAAAGATCCAGCTCTGATAATCTGGGGAATCCATCATTCTGGATCAACCACAGAACAGACCAAATTA
    TATGGAAGTGGGAGCAAACTAATAACAGTTGGGAGTTCCAATTACCAACAGTCTTTTGTACCGAGTCCAG
    GAGCGAGGCCACAAGTGAATGGCCAATCTGGACGGATCGATTTCCATTGGTTGATGCTGAATCCCAATGA
    CACAGTCACTTTCAGCTTCAATGGTGCTTTTATAGCTCCAGATCGTGCAAGTTTTCTGAGAGGGAAGTCT
    ATGGGAATTCAGAGCGATGTACAAGTTGATGCCAATTGTGAGGGGGATTGCTATCATAGTGGAGGAACAA
    TAATAAGTAATTTGCCTTTTCAGAATATCAATAGCAGAGCAGTAGGGAAATGTCCGAGGTATGTGAAACA
    AGAGAGCCTGCTACTGGCAACAGGGATGAAGAACGTTCCTGAAATTCCAAAAGGGAGAGGACTATTTGGT
    GCCATAGCGGGTTTTATTGAAAATGGGTGGGAAGGTCTGGTTGATGGATGGTATGGCTTCACACATCAAA
    ATGCACAGGGGGAGGGAACT
  • Protein Sequence : Show Sequence
    >gi|15676561|ref|NP_273705.1| outer membrane protein [Neisseria meningitidis MC58]
    MKKALATLIALALPAAALAEGASGFYVQADAAHAKASSSLGSAKGFSPRISAGYRINDLRFAVDYTRYKN
    YKAPSTDFKLYSIGASAIYDFDTQSPVKPYLGARLSLNRASVDLGGSDSFSQTSIGLGVLTGVSYAVTPN
    VDLDAGYRYNYIGKVNTVKNVRSGELSAGVRVKF
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protective antigen (Martin et al., 1997)
  • Related Vaccine(s): N. meningitidis NspA Protein Vaccine
20. P1
  • Gene Name : P1
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0011180
  • NCBI Gene ID : 902192
  • NCBI Protein GI : 15676020
  • Locus Tag : NMB0088
  • Genbank Accession : AE002098
  • Protein Accession : NP_273150
  • Taxonomy ID : 122586
  • Gene Starting Position : 99776
  • Gene Ending Position : 101176
  • Gene Strand (Orientation) : -
  • Protein Name : putative outer membrane protein P1
  • Protein pI : 9.85
  • Protein Weight : 47342.37
  • Protein Length : 466
  • Protein Note : identified by similarity to EGAD:16317; match to protein family HMM PF03349
  • DNA Sequence : Show Sequence
    >gi|77358697:99776-101176 Neisseria meningitidis MC58, complete genome
    TTTATTTGAATTTGTAGGTGTATTGCAGACCGATGATGTCGGCGTGGTTTTTGAAACGTGCGGAAGACGC
    GCCTTTGCTGTCCACATCGTTGCCGCTTGCCTTCGCCGTGCGGTAGCTGGTGTCGTTGATGTGGATGTGG
    GTGTAGGCGGCATCGACGACGTGGTTTTTACCGATATGGTATTTCATACCGGCGGAGAACCAGATGCGGT
    TGCCGTCGGGTAGGCTGTTCATGCGGTAGTCGGCGTTGCGGACGGGCGATTTGTCAAAAGCGATGCCGGC
    GCGCAGTTGCAGCGGTTCGCTGATTTGATAAGAACCGCCGAAGCCGACTTTGTAGGTGTTGCGCCAGTTG
    GGGGTGATGGTGGTGCGGTCGGATTTGCCTTTGACGACGGTTTTTTCTTTTTCAAAAACCAGTTCCGCCT
    TATCGAAGCGGCTGTGGCGCGTCCAAGTTACGTCGCCGAACAGGTCGGCTTTATCGGACACTTTGTACAT
    ACCGTGTACGGACAAAGACTCAGGCGTAACGATTTTAACGCGGGCTTTTTCATTCGCCGTGTAGCCGTTT
    GCTGCAAGCATCGTACTCCACATTGCTTTCGCCGCCGCGCCGTCTGCCGCCCATTCGGCATCGCCTTTGA
    GCGTGTGCGAGACTTTGGAACGGTAGTTCACGCCCACGCGCGCACGGTCGTTGATGTCCCACATCCACGC
    CAGTTGGTAGCCGAAGCCCCAATCGCTGCCTTTGACATCGGCGTGTCCGTCGGCCTGAATTTTTGCAGCT
    TCGGCTACACCGTTAGGTTTGGGCGGTTTTGCCGTCAATATCTCTGCTTTACTCTTAATCCCCCAGTCGG
    CATATTTGCGCAGTTCGGCGGAAGTATGTTGGGCGATGATGCCTGCGCCGAAGGAATGGCGGTCGTTGAG
    TTTCCACGCGGCGACAGGTTCGACGGCGATGCTGGTCAGACCGAGTTTGTTGATGTTGTGGCGCAACACG
    GAATCTTTTTCGTATTCGGTGGCAGAGCCGAAGGGGACGTACACGCCCAAGCCCACGGTCAGATTGTCGT
    TGACTTTGTATGCGCCGTAGATGTGGGGCGCGACCGTGGTTTTGGTGATTTTGCCGCTTTTCGAACCTTG
    GACGGGAAGCCCGGTAAAGTCGGTGGCGGAATCCGCCTCATAATGAATGCTGGGCAGCACGATGTTGGCG
    TTGACGGAAATCTGGCTGCTGTCGAGTTTGGTCAGGCCGGCAGGGTTGTAGAAGATGGTCGATGCGTCGG
    CGGCTTCTGCGGCGGCGGCATTTGCCGTGCTTTGCGCGTTGACCGACTGTGTGCCGAAGTGGTAGCCGGA
    TGCGTGGACGGATGCGGCGGCAAAGGCAGTGCCGAGCAGCAGGACGGTTTTTTTCAGTGCGGAAGGGGTC
    A
  • Protein Sequence : Show Sequence
    >gi|15676020|ref|NP_273150.1| putative outer membrane protein P1 [Neisseria meningitidis MC58]
    MTPSALKKTVLLLGTAFAAASVHASGYHFGTQSVNAQSTANAAAAEAADASTIFYNPAGLTKLDSSQISV
    NANIVLPSIHYEADSATDFTGLPVQGSKSGKITKTTVAPHIYGAYKVNDNLTVGLGVYVPFGSATEYEKD
    SVLRHNINKLGLTSIAVEPVAAWKLNDRHSFGAGIIAQHTSAELRKYADWGIKSKAEILTAKPPKPNGVA
    EAAKIQADGHADVKGSDWGFGYQLAWMWDINDRARVGVNYRSKVSHTLKGDAEWAADGAAAKAMWSTMLA
    ANGYTANEKARVKIVTPESLSVHGMYKVSDKADLFGDVTWTRHSRFDKAELVFEKEKTVVKGKSDRTTIT
    PNWRNTYKVGFGGSYQISEPLQLRAGIAFDKSPVRNADYRMNSLPDGNRIWFSAGMKYHIGKNHVVDAAY
    THIHINDTSYRTAKASGNDVDSKGASSARFKNHADIIGLQYTYKFK
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Seventeen monoclonal antibodies to one of three main cell surface antigens of Neisseria meningitidis group B were tested for protective efficacy in the infant rat using as challenge seven strains of different class 2/3 protein serotypes. Survival of the animals was regularly obtained with antibodies to the P1 protein and to LPS (Saukkonen et al., 1989).
21. rfaF
  • Gene Name : rfaF
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • NCBI Gene ID : 904029
  • NCBI Protein GI : 15677379
  • Locus Tag : NMB1527
  • Genbank Accession : AE002098
  • Protein Accession : NP_274534
  • Taxonomy ID : 122586
  • Gene Starting Position : 1577173
  • Gene Ending Position : 1578183
  • Gene Strand (Orientation) : -
  • Protein Name : ADP-heptose:LPS heptosyltransferase II
  • Protein pI : 7.02
  • Protein Weight : 35354.86
  • Protein Length : 336
  • Protein Note : identified by similarity to EGAD:40767; match to protein family HMM PF01075; match to protein family HMM TIGR02195
  • DNA Sequence : Show Sequence
    >gi|77358697:1577173-1578183 Neisseria meningitidis MC58, complete genome
    ATCATACCGCCTCTTCAACCGCCTGCACAATCTTCTCGGGATACAGCCTGTTGAGGCAGTCGGTATGCCC
    CAGCGGACATTCCCGCTTAAAACACGGCGAACATTCCAAGTGCAGGCTGACGATTTTCGCCCTATCGCTC
    AAAGGCGGCGTATGCGTCGGGCTGGAAGAACCGTAAACCGCCACCACCTTCCTGCCCAAAGCTGCCGCCA
    AATGCATCAATCCGCTGTCGTTACACACGACCGTGTCCGCCAACGACAGCAAATCCATTGCCTGCGACAA
    ATCGGTTTTGCCGCACAAATTGACACACATACCGTCTGAAAGGCGGTTGATTTCCTCGGCAATTTCATCA
    TCTTTTTGCGAACCGAACAGCCAAACCTGCCAACCCGCCGCCAGATAATGTTTGCCCAACTCGGCAAAAT
    GCCTTGTCGGCCAACGCTTTGCCGGCCCGAATTCCGCACCCGGACAAAAAGCCAGAACAGGCTTTCCAAT
    ATCCAAGCCAAAGGTTTCGACAGAAATTTCCCGCCGCCGTTCATCAATGGAAAACTCGGGGAATCCCGAA
    TGCCCGTCAAAATCTTCCTGACTCGGATGCGCGAGAGCCGTATATCGATCCACCATCAAAGGCAGACGTT
    CCTTATCCAGCCTGCGTATATCGTTCAACAGAAAATAACGGCTTTCACCGACATAACCCGTCCTTTTACC
    GATACCTGTCGCCAGCGCGATGATTGCCGATTTCAAAGAACCGGGCAACACGATAACCTGATCGTATCCG
    CGCCGCCCCAAATCCCTACCGACCCGCCAACGGCGTTTCAACTCCAACGCACCATGTCCGAACGAATTCT
    CAAGAATTTCATTCACTTCCGGCATACGCTCGAACACCGCCATCGACCACTTCGGTGCGAACACATCAAT
    CGTGCAACCGGGGTGAAGTTCCTTCAAACGGCGGAACAAGGGCTGGGTCATCACGCAGTCGCCTATCCAA
    CTGGGGGAAATAATCAGGATTTTGATGGACA
  • Protein Sequence : Show Sequence
    >gi|15677379|ref|NP_274534.1| ADP-heptose:LPS heptosyltransferase II [Neisseria meningitidis MC58]
    MSIKILIISPSWIGDCVMTQPLFRRLKELHPGCTIDVFAPKWSMAVFERMPEVNEILENSFGHGALELKR
    RWRVGRDLGRRGYDQVIVLPGSLKSAIIALATGIGKRTGYVGESRYFLLNDIRRLDKERLPLMVDRYTAL
    AHPSQEDFDGHSGFPEFSIDERRREISVETFGLDIGKPVLAFCPGAEFGPAKRWPTRHFAELGKHYLAAG
    WQVWLFGSQKDDEIAEEINRLSDGMCVNLCGKTDLSQAMDLLSLADTVVCNDSGLMHLAAALGRKVVAVY
    GSSSPTHTPPLSDRAKIVSLHLECSPCFKRECPLGHTDCLNRLYPEKIVQAVEEAV
  • Molecule Role : Virmugen
  • Molecule Role Annotation : An rfaF mutant, in combination with a siaD mutation, is attenuated in mice and induces significant protection from challenge with wild type N. meningitidis (Li et al., 2004).
  • Related Vaccine(s): Neisseria meningitidis rfaF/siaD mutant vaccine
22. siaD
  • Gene Name : siaD
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • NCBI Gene ID : 903210
  • NCBI Protein GI : 15677983
  • Locus Tag : NMB0067
  • Genbank Accession : AE002098
  • Protein Accession : NP_273131
  • Taxonomy ID : 122586
  • Gene Starting Position : 76612
  • Gene Ending Position : 77289
  • Gene Strand (Orientation) : -
  • Protein Name : polysialic acid capsule biosynthesis protein SiaD
  • Protein pI : 10.48
  • Protein Weight : 25814.56
  • Protein Length : 225
  • Protein Note : identified by similarity to GP:530041
  • DNA Sequence : Show Sequence
    >gi|77358697:76612-77289 Neisseria meningitidis MC58, complete genome
    CTTAATCGCCTTGCAGCACATCCCCCTTTCGCCAGGCAAAAAACCGGTTATATTTTTTTGCATTAAATAT
    TTTTTTAGCATATTCAGGAAAGGGGACATGCAATATGTCAAAATGATCTATATATCCTTTAATATTAAGA
    TTATTTCCAATCAAATAACGTTCTAATTTTGTTGGATGATATGAAAATGATTCTAATAAAGGAGCATATG
    TTCCAGTCCCTTCATCAATTAAATGAGTCGTAATATTCTTTTTTTTTGCAATACTAATCAGATAGGAGTA
    GTGGCCTGTAAAAGACAGCATATAGAGATGAGCAGGCTGTATAATATTAAGGATTTTTTTGTAACTTCTA
    TAAATATAAAGTAATTTTTTAGGAGTTATATTATTAGGGCTTCTAGGAAGCTCAAATAGATAAATAGATT
    CAAATAGATTCTTGTTAGCTGATTGATGAACTAACTTAGGCATTTTTAAGTTTTTAGAAGTATATAAAAT
    TACTAGTAAATTATTGGTTAATTTTTGTATTTTAATTAGGCTTTGGACTTGGTTAAGCTGACCTAAATTA
    GATATGACAAATAAATTGTTACGTGGGGGGGTAAGATAAAATGGAGATGTTGTCAACCACATTGAATCTT
    GAAAAAACTTTTTAGGCTGAAAAAGAGCTTTTTTTATTTTCTTTAGCA
  • Protein Sequence : Show Sequence
    >gi|15677983|ref|NP_273131.1| polysialic acid capsule biosynthesis protein SiaD [Neisseria meningitidis MC58]
    MLKKIKKALFQPKKFFQDSMWLTTSPFYLTPPRNNLFVISNLGQLNQVQSLIKIQKLTNNLLVILYTSKN
    LKMPKLVHQSANKNLFESIYLFELPRSPNNITPKKLLYIYRSYKKILNIIQPAHLYMLSFTGHYSYLISI
    AKKKNITTHLIDEGTGTYAPLLESFSYHPTKLERYLIGNNLNIKGYIDHFDILHVPFPEYAKKIFNAKKY
    NRFFAWRKGDVLQGD
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A siaD mutant, in combination with either a metH or rfaF mutation, is attenuated in mice and induces protection from challenge with wild type N. meningitidis (Li et al., 2004).
  • Related Vaccine(s): Neisseria meningitidis metH/siaD mutant vaccine , Neisseria meningitidis rfaF/siaD mutant vaccine
23. TBP2
  • Gene Name : TBP2
  • Sequence Strain (Species/Organism) : Neisseria meningitidis
  • VO ID : VO_0011182
  • NCBI Protein GI : 1017433
  • Other Database IDs : CDD:144774
    GOA:Q51287
    InterPro: IPR001677
    UniProtKB/TrEMBL: Q51287
  • Taxonomy ID : 487
  • Gene Strand (Orientation) : ?
  • Protein Name : transferrin-binding protein 2
  • Protein Length : 699
  • Protein Note : Transferrin binding protein-like solute binding protein; pfam01298
  • Protein Sequence : Show Sequence
    >gi|1017433|emb|CAA55541.1| TBP2 [Neisseria meningitidis]
    CLGGGGGSFDLDSVDTEAPRPAPKYQDVSSEKPQAQKDQGGYGFAMRLKRRNWYPSAKENEVKLNESDWE
    TTGLPSNPKNLPERQKSVIDQVETDGDSNNSNIYSSPYLTQSNHQNGNTGNGVNQPKNEVTDYKNFKYVY
    SGWFYKHAKREVNLAVEPKIAKNGDDGYIFYHGKDPSRQLPASGKITYKGVWHFATDTKRGQKFREIIQP
    SKNQGDRYSGFSGDDDEQYSNKNESMLKDGHEGYGFASNLEVDFDNKKLTGKLIRNNANQNNNTNNDKHT
    TQYYSLDATLKGNRFSGKAEATDKPKNDGETKEHPFVSDSSSLSGGFFGPQGEELGFRFLSNDQKVAVVG
    SAKTKDKPANGNTAEASGGTDAAASGGAAGTSSENSKLTTVLDAVELTHGGTAIKNLDNFSNAAQLVVDG
    IMIPLLPQNSTGKNNQPDQGKNGGTAFIYKTTYTPKNDDKDTKAQTVTGGTQTASNTAGDANGKTKTYEV
    EVCCSNLNYLKYGLLTRKTAGNTVGSGNSSPTAAAQTDAQSMFLQGERTDENKIPSEQNVVYRGSWYGHI
    ASSTSWSGNASDKEGGNRAEFTVNFGEKKITGTLTAENRQEATFTIDGKIEGNGFSGTAKTAELGFDLDQ
    KNTTRTPKAYITDAKVKGGFYGPKAEELGGWFAYSDDKQTKNATDASGNGNSASSATVVFGAKRQQPVQ
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Mice immunized with purified Tbp2 survived a lethal challenge to a similar degree as animals immunized with the Tbp1-Tbp2 complex, demonstrating that Tbp2 played an important role in the protective activity observed with the complex, eliciting antibodies that are not only bactericidal but also inhibitory for meningococcal growth (Lissolo et al., 1995).
  • Related Vaccine(s): N. miningitidis TBP2 Protein Vaccine
24. TbpA
  • Gene Name : TbpA
  • Sequence Strain (Species/Organism) : Neisseria meningitidis K454
  • VO ID : VO_0012380
  • NCBI Protein GI : 8926211
  • Other Database IDs : CDD:162528
    CDD:174088
    CDD:73259
  • Taxonomy ID : 487
  • Gene Strand (Orientation) : ?
  • Protein Name : transferrin-binding protein A
  • Protein Length : 915
  • Protein Note : TbpA
  • Protein Sequence : Show Sequence
    >gi|8926211|gb|AAF81744.1| transferrin-binding protein A [Neisseria meningitidis]
    MQQQHLFRFNILCLSLMTALPAYAENVQAGQAQEKQLDTIQVKAKKQKTRRDNEVTGLGKLVKSSDTLSK
    EQVLNIRDLTRYDPGIAVVEQGRGASSGYSIRGMDKNRVSLTVDGVSQIQSYTAQAALGGTRTAGSSGAI
    NEIEYENVKAVEISKGSNSVEQGSGALAGSVAFQTKTADDVIGEGRQWGIQSKTAYSGKNRGLTQSIALA
    GRIGGAEALLIHTGRRAGEIRAHEDAGRGVQSFNRLVPVEDSSNYAYFIVKEECKNGSYETCKANPKKDV
    VGKDERQTVSTRDYTGPNRFLADPLSYESRSWLFRPGFRFENKRHYIGGILEHTQQTFDTRDMTVPAFLT
    KAVFDANKKQAGSLPGNGKYAGNHKYGGLFTNGENGALVGAEYGTGVFYDETHTKSRYGLEYVYTNADKD
    TWADYARLSYDRQGVGLDNHFQQTHCSADGSDKYCRPSADKPFSYYKSDRVIYGESHRLLQAAFKKSFDT
    AKIRHNLSVNLGFDRFGSNLRHQDYYYQHANRAYSSNTPPQNNGKKISPNGSETSPYWVTIGRGNVVTGQ
    ICRLGNNTYTDCTPRSINGKSYYAAVRDNVRLGRWADVGAGLRYDYRSTHSDDGSVSTGTHRTLSWNAGI
    VLKPTDWLDLTYRTSTGFRLPSFAEMYGWRAGVQSKAVKIDPEKSFNKEAGIVFKGDFGNLEASWFNNAY
    RDLIVRGYEAQIKDGKEEAKGDPAYLNAQSARITGINILGKIDWNGVWDKLPEGWYSTFAYNRVRVRDIK
    KRADRTDIQSHLFDAIQPSRYVVGLGYDQPEGKWGVNGMLTYSKAKEITELLGSRALLNGNSRNTKATAR
    RTRPWYIVDVSGYYTVKKHFTLRAGVYNLLNYRYVTWENVRQTAGGAVNQHKNVGVYNRYAAPGRNYTFS
    LEMKF
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Recombinant TbpA protein was used in a mouse intraperitoneal-infection model to determine their ability to protect against meningococcal infection and to induce cross-reactive and bactericidal antibodies. TbpA was found to afford protection against meningococcal challenge when administered as the sole immunogen (West et al., 2001).
  • Related Vaccine(s): N. meningitidis TbpA Protein Vaccine
III. Vaccine Information
1. 5CVMB
a. Vaccine Ontology ID:
VO_0011348
b. Type:
Subunit vaccine
c. Status:
Licensed
d. Antigen
Five antigens are included: GNA2132, GNA1870, NadA, GNA1030, and GNA2091 (Giuliani et al., 2006)
e. Adjuvant: aluminum hydroxide vaccine adjuvant
  • VO ID: VO_0000127
  • Description: Adjuvant: aluminum hydroxide combined with CpG oligonucleotides (Giuliani et al., 2006)
f. Adjuvant: CpG DNA vaccine adjuvant
g. Immunization Route
Intraperitoneal injection (i.p.)
2. CCPS-P64kR
a. Type:
Conjugate vaccine
b. Status:
Research
c. Gene Engineering of LpdA
  • Type: Recombinant protein preparation
  • Description:
  • Detailed Gene Information: Click here.
d. Adjuvant: aluminum hydroxide vaccine adjuvant
e. Immunization Route
Not specified
f. Rat Response
  • Vaccination Protocol: Rat pups, aged 5 or 6 days, were injected i.p. with 100 μl of sera ( from immunized mice) previously diluted 1:10 and ferric dextran (Carmenate et al., 2004).
  • Challenge Protocol: One hour after immunization, infant rats were challenged with 107 cfu of meningococcal strain Z4181. The development of bacteremia was assessed by culturing the blood samples taken 4 h after challenge (Carmenate et al., 2004).
  • Efficacy: Sera of the challenge group of mice immunized with CCPS-P64kR showed a three-fold higher bactericidal response than the sera of the group immunized with the plain CCPS and they were able to protect against challenge with Neisseria meningococci in the infant rat protection model (Carmenate et al., 2004).
g. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: Two experiments were carried out; in both cases mice were immunized with 2.5 μg of either plain or conjugated CCPS, and Al(OH)3 as adjuvant. Two doses were given 15 days apart and 7 days after the last dose mice were bled, sera were stored at −20°C. In the first experiment four groups of 10 mice each were immunized with the following immunogens: CCPS–P64kR, CCPS–P64kC, carrier protein P64k, and plain polysaccharide. For the second experiment, four groups of 10 mice each were immunized with the three conjugates obtained from different size polysaccharides using the reductive amination method and with plain CCPS as control (Carmenate et al., 2004).
  • Challenge Protocol: Sera of immunized mice was used in rats to detect an immune response (Carmenate et al., 2004).
  • Efficacy: Sera of the challenge group immunized with CCPS-P64kR showed a three-fold higher bactericidal response than the sera of the group immunized with the plain CCPS and they were able to protect against challenge with Neisseria meningococci in the infant rat protection model (Carmenate et al., 2004).
3. Menactra
a. Product Name:
Meningococcal Polysaccharide (Serogroups A, C, Y and W-135) Diphtheria Toxoid Conjugate Vaccine
b. Tradename:
Menactra
c. Manufacturer:
Sanofi Pasteur Inc.
d. Vaccine Ontology ID:
VO_0000071
e. CDC CVX code:
114
f. Type:
Conjugate vaccine
g. Status:
Licensed
h. Location Licensed:
USA (License #1725), Canada
i. Host Species for Licensed Use:
Human
j. Allergen:
Latex
k. Preparation
Cultured on Mueller Hinton agar and grown in Watson Scherp media. The polysaccharides are extracted from the N meningitidis cells and purified by centrifugation, detergent precipitation, alcohol precipitation, solvent extraction and diafiltration (FDA: Menactra).
l. Immunization Route
Intramuscular injection (i.m.)
m. Storage
Store at 2° to 8°C (35° to 46°F). DO NOT FREEZE.
n . Approved Age for Licensed Use
2-55 years of age.
o. Contraindication
This vaccine should not be administered to anyone with known hypersensitivity to any component of Menactra vaccine including diphtheria toxoid, or a life-threatening reaction after previous administration of a vaccine containing similar components (FDA: Menactra).
p. Description
Contains Neisseria meningitidis serogroup A, C, Y and W-135 capsular polysaccharide antigens individually conjugated to diphtheria toxoid protein. Menactra vaccine is not indicated for immunization against diphtheria (FDA: Menactra).
q. Human Response
  • Immune Response: Clinical studies reported antibodies were seen in 90-100% of those who were vaccinated with Menactra (FDA: Menactra).
  • Side Effects: Side effects of vaccination include: injection site reactions, headache, fatigue, irritability and fever.
4. MenHibrix
a. Product Name:
Meningococcal Groups C and Y and Haemophilus b Tetanus Toxoid Conjugate Vaccine
b. Tradename:
MenHibrix
c. Manufacturer:
GlaxoSmithKline Biologicals
d. Type:
Conjugate vaccine
e. Status:
Licensed
f. Location Licensed:
United States
g. Host Species for Licensed Use:
Human
h. Antigen
Neisseria meningitidis serogroup C and Y capsular polysaccharide antigens and
Haemophilus b capsular polysaccharide (polyribosyl-ribitol-phosphate [PRP]) (FDA: MenHibrix).
i. Immunization Route
Intramuscular injection (i.m.)
j . Approved Age for Licensed Use
6 months to 18 years (FDA: MenHibrix)
5. Meningitec
a. Product Name:
Meningococcal Group C Conjugate Vaccine (Diphtheria CRM197 Protein)
b. Tradename:
Meningitec
c. Manufacturer:
Berna Biotech, Wyeth Canada
d. Vaccine Ontology ID:
VO_0010724
e. Type:
Subunit vaccine
f. Status:
Licensed
g. Location Licensed:
Canada
h. Host Species for Licensed Use:
Human
i. Adjuvant: Bordetella pertussis component vaccine adjuvant
  • VO ID: VO_0000193
  • Description: Products: Conjugate.
j. Allergen:
Latex in stopper of vial and plunger stopper of prefilled syringe
k. Immunization Route
Intramuscular injection (i.m.)
l. Storage
2°C to 8°C (36°F to 46°F).
m . Approved Age for Licensed Use
2 months of age and older.
n. Description
Products: Conjugate.
6. Meningococcal Polysaccharide Vaccine, Groups A & C, Menomune A/C
a. Tradename:
Meningococcal Polysaccharide Vaccine, Groups A & C, Menomune A/C
b. Manufacturer:
Sanofi Pasteur Ltd
c. Vaccine Ontology ID:
VO_0010725
d. Type:
Subunit vaccine
e. Status:
Licensed
f. Location Licensed:
Canada
g. Host Species for Licensed Use:
Human
h. Preservative:
Thimerosal
i. Allergen:
Latex in stopper of vial
j. Immunization Route
Subcutaneous injection
k. Storage
Store at at 2° to 8°C (35° to 46°F).
l . Approved Age for Licensed Use
2 years and older.
m. Description
Products: Polysaccharide. Other components: Lactose.
7. Menjugate
a. Product Name:
Meningococcal Group C CRM-197 Conjugate Vaccine
b. Tradename:
Menjugate
c. Manufacturer:
Novartis Vaccines and Diagnostics
d. Vaccine Ontology ID:
VO_0010726
e. Type:
Conjugate vaccine
f. Status:
Licensed
g. Location Licensed:
Canada
h. Host Species for Licensed Use:
Human
i. Adjuvant: aluminum hydroxide vaccine adjuvant
j. Immunization Route
Intramuscular injection (i.m.)
k. Storage
Do not store above 25° C.
l . Approved Age for Licensed Use
2 months and older.
m. Description
Products: Conjugate.
8. Menomune-A/C/Y/W-135
a. Product Name:
Meningococcal Polysaccharide Vaccine, Groups A, C, Y, W135 Combined
b. Tradename:
Menomune-A/C/Y/W-135
c. Manufacturer:
Sanofi Pasteur, Inc.
d. Vaccine Ontology ID:
VO_0000072
e. CDC CVX code:
32
f. Type:
Live, attenuated vaccine
g. Status:
Licensed
h. Location Licensed:
USA (License #1725)
i. Host Species for Licensed Use:
Human
j. Antigen
Meningococcal Polysaccharide Vaccine, Groups A, C, Y and W-135 Combined
k. Preparation
MEMOMUNE is cultivated with Mueller Hinton agar and Watson Scherp media and is freeze-dried with the group-specific polysaccharide antigens from Neisseria meningitidis, Group A, Group C, Group Y and Group W-135 (FDA: Menomune– A/C/Y/W-135).
l. Immunization Route
subcutaneous injection
m. Storage
Store the freeze-dried vaccine and reconstituted vaccine, when not in use, at 2° to 8°C (35° to 46°F).
n . Approved Age for Licensed Use
2 years of age and older
o. Contraindication
Individuals with known sensitivity to thimerosal or any other component of the vaccine.
p. Description
Meningococcal Polysaccharide Vaccine, Groups A, C, Y and W-135 Combined, is indicated for active immunization against invasive meningococcal disease caused by these serogroups (FDA: Menomune– A/C/Y/W-135).
q. Human Response
  • Immune Response: Measurable levels of antibodies against the group A and C polysaccharides decrease markedly during the first 3 years following a single dose of vaccine (FDA: Menomune– A/C/Y/W-135).
  • Side Effects: Side effects of vaccination include: pain and redness of injection site, fever and/or headache (FDA: Menomune– A/C/Y/W-135).
  • Efficacy: The serogroup A polysaccharide induces and antibody response in children as young as 3 months of age, the serogroup C component can be poorly immunogenic in recipients who are less than 18 to 24 months of age 5. The serogroups A and C have demonstrated estimated clinical efficacies of 85% to 100% in older children and adults. Serogroups Y and W-135 polysaccharides are safe and immunogenic in adults and in children greater than 2 years of age (FDA: Menomune– A/C/Y/W-135).
9. Menveo
a. Product Name:
Meningococcal (Groups A, C, Y and W-135) Oligosaccharide Diphtheria CRM197 Conjugate Vaccine
b. Tradename:
Menveo
c. Manufacturer:
Novartis Vaccines and Diagnostics, Inc.
d. Vaccine Ontology ID:
VO_0001246
e. CDC CVX code:
136
f. Type:
Conjugate vaccine
g. Status:
Licensed
h. Location Licensed:
USA, Canada
i. Host Species for Licensed Use:
Human
j. Antigen
N. meningitidis serogroup A, C, Y and W-135 oligosaccharides conjugated individually to Corynebacterium diphtheriae CRM197 protein (FDA: Menveo).
k. Preparation
The polysaccharides are produced by bacterial fermentation of N. meningitidis (serogroups A, C, Y or W-135). N. meningitidis strains A, C, Y and W-135 are each cultured and grown on Franz Complete medium and treated with formaldehyde. MenA, MenW-135 and MenY polysaccharides are purified by several extraction and precipitation steps. MenC polysaccharide is purified by a combination of chromatography and precipitation steps. The protein carrier (CRM197) is produced by bacterial fermentation and is purified by a series of chromatography and ultrafiltration steps. C. diphtheriae is cultured and grown on CY medium containing yeast extracts and amino acids. The oligosaccharides are prepared for conjugation from purified polysaccharides by hydrolysis, sizing, and reductive amination. After activation, each oligosaccharide is covalently linked to the CRM197 protein. The resulting glycoconjugates are purified to yield the four drug substances, which compose the final vaccine (FDA: Menveo).
l. Immunization Route
Intramuscular injection (i.m.)
m. Storage
Store refrigerated, away from the freezer compartment, at 36°F to 46°F (2°C to 8°C). Keep away from light (FDA: Menveo).
n . Approved Age for Licensed Use
MENVEO is approved for use in persons 11 to 55 years of age (FDA: Menveo).
o. Description
MENVEO [Meningococcal (Groups A, C, Y and W-135) Oligosaccharide Diphtheria CRM197 Conjugate Vaccine] is a sterile liquid vaccine administered by intramuscular injection that contains N. meningitidis serogroup A, C, Y and W-135 oligosaccharides conjugated individually to Corynebacterium diphtheriae CRM197 protein (FDA: Menveo).
10. N. meningitidis DNA vaccine P3A
a. Type:
DNA vaccine
b. Status:
Research
c. Host Species as Laboratory Animal Model:
Mouse
d. Antigen
a T-cell helper epitope and a peptide mimic of N. meningitidis serogroup C (Prinz et al., 2003)
e. Gene Engineering of gp120
  • Type: DNA vaccine construction
  • Description: The T-cell epitope used was from HIV gp120 (Prinz et al., 2003).
  • Detailed Gene Information: Click here.
f. Vector:
pcDNA3.1 (Prinz et al., 2003)
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Vaccine Immune Response Type: VO_0003057
  • Immune Response: Mice immunized with P3A DNA produced an anti-MCPS IgM antibody response that was significantly higher (P < 0.05) than that of mice immunized with P3C DNA (negative control) (Prinz et al., 2003).
  • Efficacy: Mice immunized with P3A DNA were protected against meningococcal infection, with 100% survival. Five of the six mice immunized with P3C DNA (negative control) died within 24 hr postchallenge (Prinz et al., 2003).
11. N. meningitidis ExbB Protein Vaccine
a. Type:
Subunit vaccine
b. Status:
Research
c. Gene Engineering of ExbB
  • Type: Recombinant protein preparation
  • Description:
  • Detailed Gene Information: Click here.
d. Adjuvant: incomplete Freund's adjuvant
e. Immunization Route
Subcutaneous injection
f. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: To examine the protective efficacy of recombinant proteins, adult mice (6-week-old, female BALB/c animals, 35 per group) were immunised on days 1 and 21 with 25 μg of antigen given by subcutaneous (s.c.) injection. Each protein was mixed with Freund's incomplete adjuvant (50% v/v) prior to administration. Mice in control groups were immunised with adjuvant alone or recombinant homologous PorA prior to challenge (Sun et al., 2005).
  • Challenge Protocol: 28 days after immunization, animals were challenged with live bacteria at either a high (107 CFU, 15 mice) or low (106 CFU, 15 mice) dose of MC58 (Sun et al., 2005).
  • Efficacy: ExbB, which is required for iron acquisition, elicited protective immunity and was able to protect mice from bacterial challenge (Sun et al., 2005).
12. N. meningitidis LctP Protein Vaccine
a. Type:
Subunit vaccine
b. Status:
Research
c. Gene Engineering of LctP
  • Type: Recombinant protein preparation
  • Description:
  • Detailed Gene Information: Click here.
d. Adjuvant: incomplete Freund's adjuvant
e. Immunization Route
Subcutaneous injection
f. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: To examine the protective efficacy of recombinant proteins, adult mice (6-week-old, female BALB/c animals, 35 per group) were immunised on days 1 and 21 with 25 μg of LctP given by subcutaneous (s.c.) injection. Each protein was mixed with Freund's incomplete adjuvant (50% v/v) prior to administration. Mice in control groups were immunised with adjuvant alone or recombinant homologous PorA prior to challenge (Sun et al., 2005).
  • Challenge Protocol: 28 days after immunization, animals were challenged with live bacteria at either a high (107 CFU, 15 mice) or low (106 CFU, 15 mice) dose of MC58 (Sun et al., 2005).
  • Efficacy: LctP which is required for iron acquisition, elicited protective immunity and was able to protect mice from bacterial challenge (Sun et al., 2005).
13. N. meningitidis NspA Protein Vaccine
a. Type:
Subunit vaccine
b. Status:
Research
c. Gene Engineering of NspA from N. meningitidis MC58
  • Type: Recombinant protein preparation
  • Description:
  • Detailed Gene Information: Click here.
d. Adjuvant: QuilA vaccine adjuvant
  • VO ID: VO_0001263
  • Description: QuilA (CedarLane Laboratories, Hornby, Ontario, Canada) (Martin et al., 1997).
e. Immunization Route
Intraperitoneal injection (i.p.)
f. Mouse Response
  • Vaccination Protocol: Groups of mice were injected three times at 3-wk intervals with 10 or 20 μg of affinity-purified NspA recombinant protein and 25 μg of QuilA (CedarLane Laboratories, Hornby, Ontario, Canada) as the adjuvant. Control mice were injected with either 20 μg of BSA (Sigma), concentrated E. coli BL21(DE3) supernatant, or PBS. 2 wk after the third injection the mice were used for the protection experiments (Martin et al., 1997).
  • Challenge Protocol: For inoculation of mice, meningococci were removed from the chocolate agar plates after ∼20 h of incubation and suspended in PBS and injected into mice (Martin et al., 1997).
  • Efficacy: 80% of the mice immunized with three injections of either 10 or 20 μg of purified recombinant meningococcal NspA protein survived the bacterial challenge comparatively to 0 to 20% in the control groups. Survivors at 72 h did not succumb during an additional two weeks of observation. The mice in the control group injected with concentrated E. coli culture supernatant were not protected against the bacterial challenge indicating that the components present in the culture media and other E. coli antigens that might be present in small amounts after purification do not contribute to the observed protection against N. meningitidis (Martin et al., 1997).
14. N. meningitidis TbpA Protein Vaccine
a. Type:
Subunit vaccine
b. Status:
Research
c. Antigen
rTbpA
d. Gene Engineering of TbpA
  • Type: Recombinant protein preparation
  • Description:
  • Detailed Gene Information: Click here.
e. Adjuvant: complete Freund's adjuvant
  • VO ID: VO_0000139
  • Description: Vaccines were prepared with an equal volume of either Freund's complete adjuvant (first immunization) or Freund's incomplete adjuvant (subsequent immunizations) (West et al., 2001).
f. Adjuvant: incomplete Freund's adjuvant
  • VO ID: VO_0000142
  • Description: Vaccines were prepared with an equal volume of either Freund's complete adjuvant (first immunization) or Freund's incomplete adjuvant (subsequent immunizations) (West et al., 2001).
g. Immunization Route
subcutaneous injection
h. Mouse Response
  • Host Strain: NIH
  • Vaccination Protocol: Each mouse received 0.2 ml, containing 10 μg of rTbpA protein and Freund's complete adjuvant, by subcutaneous injection. All animals were immunized on days 1, 21, and 28 (West et al., 2001).
  • Challenge Protocol: Mice were infected by intraperitoneal injection of N. meningitidis at several challenge doses (West et al., 2001).
  • Efficacy: 100% protection was afforded by vaccination with rTbpA at the 2 × 107 CFU challenge dose andat the 2 × 108 CFU challenge dose, the rTbpA-vaccinated group had an 85% survival rate (West et al., 2001).
15. N. miningitidis TBP2 Protein Vaccine
a. Type:
Subunit vaccine
b. Status:
Research
c. Gene Engineering of TBP2
  • Type: Recombinant protein preparation
  • Description:
  • Detailed Gene Information: Click here.
d. Adjuvant: aluminum hydroxide vaccine adjuvant
e. Immunization Route
Subcutaneous Injection
f. Mouse Response
  • Vaccination Protocol: Groups of 48 mice were immunized subcutaneously on days 0, 21, and 35 with different vaccine preparations containing 5 mg of protein adsorbed onto 0.1 mg of aluminum hydroxide per 0.5 ml; PBS containing aluminum hydroxide and heat-inactivated N. meningitidis B16B6 were used as controls (Lissolo et al., 1995).
  • Challenge Protocol: 41 days after immunization, mice within a group were subdivided into groups of eight, and each subgroup received by the intraperitoneal route 24 mg of iron-loaded hTf (Sigma) and, immediately after by the intraperitoneal route, 0.5 ml of N. meningitidis grown under iron restriction. The bacterial load varied from 104 to 108 CFU. Mortality rates were measured for 5 days following challenge (Lissolo et al., 1995).
  • Efficacy: Mice immunized with purified Tbp2 survived a lethal challenge to a similar degree as animals immunized with the Tbp1-Tbp2 complex, demonstrating that Tbp2 played an important role in the protective activity observed with the complex, eliciting antibodies that are not only bactericidal but also inhibitory for meningococcal growth (Lissolo et al., 1995).
16. Neisseria meningitidis metH/siaD mutant vaccine
a. Type:
Live, attenuated vaccine
b. Status:
Research
c. Host Species as Laboratory Animal Model:
Mouse
d. Gene Engineering of metH
  • Type: Gene mutation
  • Description: This metH/siaD mutant is from Neisseria meningitidis (Li et al., 2004).
  • Detailed Gene Information: Click here.
e. Gene Engineering of siaD
  • Type: Gene mutation
  • Description: This metH/siaD mutant is from Neisseria meningitidis (Li et al., 2004).
  • Detailed Gene Information: Click here.
f. Gene Engineering of siaD
  • Type: Gene mutation
  • Description: This metH/siaD mutant is from Neisseria meningitidis (Li et al., 2004).
  • Detailed Gene Information: Click here.
g. Immunization Route
Intraperitoneal injection (i.p.)
h. Mouse Response
  • Persistence: A metH/siaD mutant is attenuated in mice (Li et al., 2004).
  • Efficacy: A metH/siaD mutant induces significant protection in mice from challenge with wild type neisseria meningitidis (Li et al., 2004).
17. Neisseria meningitidis rfaF/siaD mutant vaccine
a. Type:
Live, attenuated vaccine
b. Status:
Research
c. Host Species as Laboratory Animal Model:
Mouse
d. Gene Engineering of rfaF
  • Type: Gene mutation
  • Description: This rfaF/siaD mutant is from Neisseria meningitidis (Li et al., 2004).
  • Detailed Gene Information: Click here.
e. Gene Engineering of siaD
  • Type: Gene mutation
  • Description: This rfaF/siaD mutant is from Neisseria meningitidis (Li et al., 2004).
  • Detailed Gene Information: Click here.
f. Immunization Route
Intraperitoneal injection (i.p.)
g. Mouse Response
  • Persistence: A rfaF/siaD mutant is attenuated in mice (Li et al., 2004).
  • Efficacy: An rfaF/siaD mutant induces significant protection in mice from challenge with wild type Neisseria meningitidis (Li et al., 2004).
18. Neisvac-C
a. Product Name:
Meningococcal Group C-TT Conjugate Vaccine, Adsorbed
b. Tradename:
Neisvac-C
c. Manufacturer:
Baxter Healthcare Corporation, GlaxoSmithKline
d. Vaccine Ontology ID:
VO_0010729
e. Type:
Conjugate vaccine
f. Status:
Licensed
g. Location Licensed:
Canada
h. Host Species for Licensed Use:
Human
i. Adjuvant: aluminum hydroxide vaccine adjuvant
j. Immunization Route
Intramuscular injection (i.m.)
k. Storage
Store at 2°C to 8°C.
l . Approved Age for Licensed Use
2 months of age and older.
m. Description
Products: Conjugate.
IV. References
1. Carmenate et al., 2004: Carmenate T, Canaán L, Alvarez A, Delgado M, González S, Menéndez T, Rodés L, Guillén G. Effect of conjugation methodology on the immunogenicity and protective efficacy of meningococcal group C polysaccharide-P64k protein conjugates. FEMS immunology and medical microbiology. 2004; 40(3); 193-199. [PubMed: 15039094].
2. Comanducci et al., 2002: Comanducci M, Bambini S, Brunelli B, Adu-Bobie J, Aricò B, Capecchi B, Giuliani MM, Masignani V, Santini L, Savino S, Granoff DM, Caugant DA, Pizza M, Rappuoli R, Mora M. NadA, a novel vaccine candidate of Neisseria meningitidis. The Journal of experimental medicine. 2002; 195(11); 1445-1454. [PubMed: 12045242].
3. FDA: Menactra: FDA: Menactra [http://www.fda.gov/BiologicsBloodVaccines/Vaccines/ApprovedProducts/ucm094053.htm]
4. FDA: MenHibrix: FDA: MenHibrix Package insert [http://www.fda.gov/BiologicsBloodVaccines/Vaccines/ApprovedProducts/ucm308566.htm]
5. FDA: Menomune– A/C/Y/W-135: FDA Menomune– A/C/Y/W-135 Neisseria meningitidis vaccine [http://www.fda.gov/BiologicsBloodVaccines/Vaccines/ApprovedProducts/ucm094054.htm]
6. FDA: Menveo: FDA: Menveo [http://www.fda.gov/BiologicsBloodVaccines/Vaccines/ApprovedProducts/ucm201342.htm]
7. Giuliani et al., 2006: Giuliani MM, Adu-Bobie J, Comanducci M, Aricò B, Savino S, Santini L, Brunelli B, Bambini S, Biolchi A, Capecchi B, Cartocci E, Ciucchi L, Di Marcello F, Ferlicca F, Galli B, Luzzi E, Masignani V, Serruto D, Veggi D, Contorni M, Morandi M, Bartalesi A, Cinotti V, Mannucci D, Titta F, Ovidi E, Welsch JA, Granoff D, Rappuoli R, Pizza M. A universal vaccine for serogroup B meningococcus. Proceedings of the National Academy of Sciences of the United States of America. 2006; 103(29); 10834-10839. [PubMed: 16825336].
8. Li et al., 2004: Li Y, Sun YH, Ison C, Levine MM, Tang CM. Vaccination with attenuated Neisseria meningitidis strains protects against challenge with live Meningococci. Infection and immunity. 2004; 72(1); 345-351. [PubMed: 14688114].
9. Lissolo et al., 1995: Lissolo L, Maitre-Wilmotte G, Dumas P, Mignon M, Danve B, Quentin-Millet MJ. Evaluation of transferrin-binding protein 2 within the transferrin-binding protein complex as a potential antigen for future meningococcal vaccines. Infection and immunity. 1995; 63(3); 884-890. [PubMed: 7868259].
10. Martin et al., 1997: Martin D, Cadieux N, Hamel J, Brodeur BR. Highly conserved Neisseria meningitidis surface protein confers protection against experimental infection. The Journal of experimental medicine. 1997; 185(7); 1173-1183. [PubMed: 9104804].
11. O'dwyer et al., 2004: O'dwyer CA, Reddin K, Martin D, Taylor SC, Gorringe AR, Hudson MJ, Brodeur BR, Langford PR, Kroll JS. Expression of heterologous antigens in commensal Neisseria spp.: preservation of conformational epitopes with vaccine potential. Infection and immunity. 2004; 72(11); 6511-6518. [PubMed: 15501782].
12. Pizza et al., 2000: Pizza M, Scarlato V, Masignani V, Giuliani MM, Aricò B, Comanducci M, Jennings GT, Baldi L, Bartolini E, Capecchi B, Galeotti CL, Luzzi E, Manetti R, Marchetti E, Mora M, Nuti S, Ratti G, Santini L, Savino S, Scarselli M, Storni E, Zuo P, Broeker M, Hundt E, Knapp B, Blair E, Mason T, Tettelin H, Hood DW, Jeffries AC, Saunders NJ, Granoff DM, Venter JC, Moxon ER, Grandi G, Rappuoli R. Identification of vaccine candidates against serogroup B meningococcus by whole-genome sequencing. Science (New York, N.Y.). 2000; 287(5459); 1816-1820. [PubMed: 10710308].
13. Pizza et al., 2008: Pizza M, Donnelly J, Rappuoli R. Factor H-binding protein, a unique meningococcal vaccine antigen. Vaccine. 2008; 26 Suppl 8; I46-48. [PubMed: 19388164].
14. Prinz et al., 2003: Prinz DM, Smithson SL, Kieber-Emmons T, Westerink MA. Induction of a protective capsular polysaccharide antibody response to a multiepitope DNA vaccine encoding a peptide mimic of meningococcal serogroup C capsular polysaccharide. Immunology. 2003; 110(2); 242-249. [PubMed: 14511238].
15. Saukkonen et al., 1989: Saukkonen K, Leinonen M, Abdillahi H, Poolman JT. Comparative evaluation of potential components for group B meningococcal vaccine by passive protection in the infant rat and in vitro bactericidal assay. Vaccine. 1989; 7(4); 325-328. [PubMed: 2510417].
16. Stephens et al., 2007: Stephens DS, Greenwood B, Brandtzaeg P. Epidemic meningitis, meningococcaemia, and Neisseria meningitidis. Lancet. 2007; 369(9580); 2196-2210. [PubMed: 17604802].
17. Sun et al., 2005: Sun Y, Li Y, Exley RM, Winterbotham M, Ison C, Smith H, Tang CM. Identification of novel antigens that protect against systemic meningococcal infection. Vaccine. 2005; 23(32); 4136-4141. [PubMed: 15964482].
18. Textbook of Bacteriology: Staphylococcus bacteriaPrint this Page Pathogenic Neisseriae: Gonorrhea, Neonatal Ophthalmia and Meningococcal Meningitis [http://textbookofbacteriology.net/neisseria]
19. West et al., 2001: West D, Reddin K, Matheson M, Heath R, Funnell S, Hudson M, Robinson A, Gorringe A. Recombinant Neisseria meningitidis transferrin binding protein A protects against experimental meningococcal infection. Infection and immunity. 2001; 69(3); 1561-1567. [PubMed: 11179327].