VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Japanese encephalitis virus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Microbial Pathogenesis
    5. Host Ranges and Animal Models
    6. Host Protective Immunity
  2. Vaccine Related Pathogen Genes
    1. E protein from West Nile Virus (Other)
    2. PrM from West Nile Virus (Other)
    3. Envelope protein (Protective antigen)
    4. M protein (Protective antigen)
    5. NS1 (Protective antigen)
    6. NS3 (Protective antigen)
    7. NS5 (Protective antigen)
    8. PreM (Protective antigen)
    9. PrM (Protective antigen)
  3. Vaccine Related Host Genes
    1. Ifng (Interferon gamma)
  4. Vaccine Information
    1. ALVAC-JEV
    2. Ixiaro
    3. Japanese encephalitis virus (JEV)
    4. Japanese encephalitis virus DNA vaccine encoding E protein
    5. Japanese encephalitis virus DNA vaccine encoding NS1 (pUSK-NS1)
    6. Japanese encephalitis virus DNA vaccine encoding PrM
    7. Japanese encephalitis virus DNA Vaccine P-JEV
    8. Japanese encephalitis virus DNA Vaccine pCJ-3/E encoding E
    9. Japanese encephalitis virus DNA vaccine pUJENS3
    10. Japanese encephalitis virus DNA vaccine pUJENS5
    11. Japanese encephalitis virus vaccine BV-G-E
    12. JE-Vax
    13. NYVAC-JEV
    14. NYVAC-JEV- prM/E/ NS1
  5. References
I. General Information
1. NCBI Taxonomy ID:
11072
2. Disease:
Japanese encephalitis
3. Introduction
Japanese encephalitis virus is a virus from the family Flaviviridae. It causes the mosquito-borne Japanese encephalitis. Japanese encephalitis is the leading cause of viral encephalitis in Asia, with 30,000–50,000 cases reported annually. Case-fatality rates range from 0.3% to 60% and depends on the population and on age. Rare outbreaks in U.S. territories in Western Pacific have occurred. This disease often occurs in rural areas but not usually in urban areas. Severe rigors, fever, headache and malaise are non-specific symptoms for the first week. Signs which develop during the acute encephalitic stage include neck rigidity, cachexia, hemiparesis, convulsions, and fever. Mental retardation developed from this disease usually leads to coma. Mortality of this disease varies but is generally much higher in children (Wiki: Japanese encephalitis).
4. Microbial Pathogenesis
Japanese encephalitis virus infects the lumen of the endoplasmic reticulum and rapidly accumulates substantial amounts of viral proteins.
5. Host Ranges and Animal Models
Domestic pigs and wild birds are reservoirs of the virus; transmission to humans may cause severe symptoms.
6. Host Protective Immunity
Infection with JEV confers life-long immunity (Wiki: Japanese encephalitis). For JE, both arms have been considered to be important for protection from the disease, since passive transfer of neutralizing antibodies or virus-specific T cells including CTLs can protect mice from a lethal challenge (Konishi et al., 2003).
1. E protein from West Nile Virus
  • Gene Name : E protein from West Nile Virus
  • Sequence Strain (Species/Organism) : West Nile virus NY99
  • NCBI Gene ID : 5714902
  • NCBI Protein GI : 158516888
  • Locus Tag : WNVNY99_gp1
  • Genbank Accession : DQ211652
  • Protein Accession : YP_001527877
  • Taxonomy ID : 11082
  • Gene Starting Position : 96
  • Gene Ending Position : 10397
  • Gene Strand (Orientation) : +
  • Protein Name : polyprotein
  • Protein pI : 8.52
  • Protein Weight : 353459.58
  • Protein Length : 3433
  • DNA Sequence : Show Sequence
    >gi|158516887:96-10397 West Nile virus, complete genome
    GATGTCTAAGAAACCAGGAGGGCCCGGCAAGAGCCGGGCTGTCAATATGCTAAAACGCGGAATGCCCCGC
    GTGTTGTCCTTGATTGGACTGAAGAGGGCTATGTTGAGCCTGATCGACGGCAAGGGGCCAATACGATTTG
    TGTTGGCTCTCTTGGCGTTCTTCAGGTTCACAGCAATTGCTCCGACCCGAGCAGTGCTGGATCGATGGAG
    AGGTGTGAACAAACAAACAGCGATGAAACACCTTCTGAGTTTTAAGAAGGAACTAGGGACCTTGACCAGT
    GCTATCAATCGGCGGAGCTCAAAACAAAAGAAAAGAGGAGGAAAGACCGGAATTGCAGTCATGATTGGCC
    TGATCGCCAGCGTAGGAGCAGTTACCCTCTCTAACTTCCAAGGGAAGGTGATGATGACGGTAAATGCTAC
    TGACGTCACAGATGTCATCACGATTCCAACAGCTGCTGGAAAGAACCTATGCATTGTCAGAGCAATGGAT
    GTGGGATACATGTGCGATGATACTATCACTTATGAATGCCCAGTACTGTCGGCTGGTAATGATCCAGAAG
    ACATCGACTGTTGGTGCACAAAGTCAGCAGTCTACGTCAGGTATGGAAGATGCACCAAGACACGCCACTC
    AAGACGCAGTCGGAGGTCACTGACAGTGCAGACACACGGAGAAAGCACTCTAGCGAACAAGAAGGGGGCT
    TGGATGGACAGCACCAAGGCCACAAGGTATTTGGTAAAAACAGAATCATGGATCTTGAGGAACCCTGGAT
    ATGCCCTGGTGGCAGCCGTCATTGGTTGGATGCTTGGGAGCAACACCATGCAGAGAGTTGTGTTTGTCGT
    GCTATTGCTTTTGGTGGCCCCAGCTTACAGCTTCAACTGCCTTGGAATGAGCAACAGAGACTTCTTGGAA
    GGAGTGTCTGGAGCAACATGGGTGGATTTGGTTCTCGAAGGCGACAGCTGCGTGACTATCATGTCTAAGG
    ACAAGCCTACCATCGATGTGAAGATGATGAATATGGAGGCGGCCAACCTGGCAGAGGTCCGCAGTTATTG
    CTATTTGGCTACCGTCAGCGATCTCTCCACCAAAGCTGCGTGCCCGACCATGGGAGAAGCTCACAATGAC
    AAACGTGCTGACCCAGCTTTTGTGTGCAGACAAGGAGTGGTGGACAGGGGCTGGGGCAACGGCTGCGGAC
    TATTTGGCAAAGGAAGCATTGACACATGCGCCAAATTTGCCTGCTCTACCAAGGCAATAGGAAGAACCAT
    CTTGAAAGAGAATATCAAGTACGAAGTGGCCATTTTTGTCCATGGACCAACTACTGTGGAGTCGCACGGA
    AACTACTCCACACAGGTTGGAGCCACTCAGGCAGGGAGACTCAGCATCACTCCTGCGGCGCCTTCATACA
    CACTAAAGCTTGGAGAATATGGAGAGGTGACAGTGGACTGTGAACCACGGTCAGGGATTGACACCAATGC
    ATACTACGTGATGACTGTTGGAACAAAGACGTTCTTGGTCCATCGTGAGTGGTTCATGGACCTCAACCTC
    CCTTGGAGCAGTGCTGGAAGTACTGTGTGGAGGAACAGAGAGACGTTAATGGAGTTTGAGGAACCACACG
    CCACGAAGCAGTCTGTGATAGCATTGGGCTCACAAGAGGGAGCTCTGCATCAAGCTTTGGCTGGAGCCAT
    TCCTGTGGAATTTTCAAGCAACACTGTCAAGTTGACGTCGGGTCATTTGAAGTGTAGAGTGAAGATGGAA
    AAATTGCAGTTGAAGGGAACAACCTATGGCGTCTGTTCAAAGGCTTTCAAGTTTCTTGGGACTCCCGCAG
    ACACAGGTCACGGCACTGTGGTGTTGGAATTGCAGTACACTGGCACGGATGGACCTTGCAAAGTTCCTAT
    CTCGTCAGTGGCTTCATTGAACGACCTAACGCCAGTGGGCAGATTGGTCACTGTCAACCCTTTTGTTTCA
    GTGGCCACGGCCAACGCTAAGGTCCTGATTGAATTGGAACCACCCTTTGGAGACTCATACATAGTGGTGG
    GCAGAGGAGAACAACAGATCAATCACCATTGGCACAAGTCTGGAAGCAGCATTGGCAAAGCCTTTACAAC
    CACCCTCAAAGGAGCGCAGAGACTAGCCGCTCTAGGAGACACAGCTTGGGACTTTGGATCAGTTGGAGGG
    GTGTTCACCTCAGTTGGGAAGGCTGTCCATCAAGTGTTCGGAGGAGCATTCCGCTCACTGTTCGGAGGCA
    TGTCCTGGATAACGCAAGGATTGCTGGGGGCTCTCCTGTTGTGGATGGGCATCAATGCTCGTGATAGGTC
    CATAGCTCTCACGTTTCTCGCAGTTGGAGGAGTTCTGCTCTTCCTCTCCGTGAACGTGCACGCTGACACT
    GGGTGTGCCATAGACATCAGCCGGCAAGAGCTGAGATGTGGAAGTGGAGTGTTCATACACAATGATGTGG
    AGGCTTGGATGGACCGGTACAAGTATTACCCTGAAACGCCACAAGGCCTAGCCAAGATCATTCAGAAAGC
    TCATAAGGAAGGAGTGTGCGGTCTACGATCAGTTTCCAGACTGGAGCATCAAATGTGGGAAGCAGTGAAG
    GACGAGCTGAACACTCTTTTGAAGGAGAATGGTGTGGACCTTAGTGTCGTGGTTGAGAAACAGGAGGGAA
    TGTACAAGTCAGCACCTAAACGCCTCACCGCCACCACGGAAAAATTGGAAATTGGCTGGAAGGCCTGGGG
    AAAGAGTATTTTATTTGCACCAGAACTCGCCAACAACACCTTTGTGGTTGATGGTCCGGAGACCAAGGAA
    TGTCCGACTCAGAATCGCGCTTGGAATAGCTTAGAAGTGGAGGATTTTGGATTTGGTCTCACCAGCACTC
    GGATGTTCCTGAAGGTCAGAGAGAGCAACACAACTGAATGTGACTCGAAGATCATTGGAACGGCTGTCAA
    GAACAACTTGGCGATCCACAGTGACCTGTCCTATTGGATTGAAAGCAGGCTCAATGATACGTGGAAGCTT
    GAAAGGGCAGTTCTGGGTGAAGTCAAATCATGTACGTGGCCTGAGACGCATACCTTGTGGGGCGATGGAA
    TCCTTGAGAGTGACTTGATAATACCAGTCACACTGGCGGGACCACGAAGCAATCACAATCGGAGACCTGG
    GTACAAGACACAAAACCAGGGCCCATGGGACGAAGGCCGGGTAGAGATTGACTTCGATTACTGCCCAGGA
    ACTACGGTCACCCTGAGTGAGAGCTGCGGACACCGTGGACCTGCCACTCGCACCACCACAGAGAGCGGAA
    AGTTGATAACAGATTGGTGCTGCAGGAGCTGCACCTTACCACCACTGCGCTACCAAACTGACAGCGGCTG
    TTGGTATGGTATGGAGATCAGACCACAGAGACATGATGAAAAGACCCTCGTGCAGTCACAAGTGAATGCT
    TATAATGCTGATATGATTGACCCTTTTCAGTTGGGCCTTCTGGTCGTGTTCTTGGCCACCCAGGAGGTCC
    TTCGCAAGAGGTGGACAGCCAAGATCAGCATGCCAGCTATACTGATTGCTCTGCTAGTCCTGGTGTTTGG
    GGGCATTACTTACACTGATGTGTTACGCTATGTCATCTTGGTGGGGGCAGCTTTCGCAGAATCTAATTCG
    GGAGGAGACGTGGTACACTTGGCGCTCATGGCGACCTTCAAGATACAACCAGTGTTTATGGTGGCATCGT
    TTCTCAAAGCGAGATGGACCAACCAGGAGAACATTTTGTTGATGTTGGCGGCTGTTTTCTTTCAAATGGC
    TTATCACGATGCCCGCCAAATTCTGCTCTGGGAGATCCCTGATGTGTTGAATTCACTGGCGGTAGCTTGG
    ATGATACTGAGAGCCATAACATTCACAACGACATCAAACGTGGTTGTTCCGCTGCTAGCCCTGCTAACAC
    CCGGGCTGAGATGCTTGAATCTGGATGTGTACAGGATACTGCTGTTGATGGTCGGAATAGGCAGCTTGAT
    CAGGGAGAAGAGGAGTGCAGCCGCAAAAAAGAAAGGAGCAAGTCTGCTATGCTTGGCTCTAGCCTCAACA
    GGACTTTTCAACCCCATGATCCTTGCTGCTGGACTGATTGCATGTGATCCCAACCGTAAACGCGGATGGC
    CCGCAACTGAAGTGATGACAGCTGTCGGCCTAATGTTTGCCATCGTCGGAGGGCTGGCAGAGCTTGACAT
    TGACTCCATGGCCATTCCAATGACTATCGCGGGGCTCATGTTTGCTGCTTTCGTGATTTCTGGGAAATCA
    ACAGATATGTGGATTGAGAGAACGGCGGACATTTCCTGGGAAAGTGATGCAGAAATTACAGGCTCGAGCG
    AAAGAGTTGATGTGCGGCTTGATGATGATGGAAACTTCCAGCTCATGAATGATCCAGGAGCACCTTGGAA
    GATATGGATGCTCAGAATGGTCTGTCTCGCGATTAGTGCGTACACCCCCTGGGCAATCTTGCCCTCAGTA
    GTTGGATTTTGGATAACTCTCCAATACACAAAGAGAGGAGGCGTGTTGTGGGACACTCCCTCACCAAAGG
    AGTACAAAAAGGGGGACACGACCACCGGCGTCTACAGGATCATGACTCGTGGGCTGCTCGGCAGTTATCA
    AGCAGGAGCGGGCGTGATGGTTGAAGGTGTTTTCCACACCCTTTGGCATACAACAAAAGGAGCCGCTTTG
    ATGAGCGGAGAGGGCCGCCTGGACCCATACTGGGGCAGTGTCAAGGAGGATCGACTTTGTTACGGAGGAC
    CCTGGAAATTGCAGCACAAGTGGAACGGGCAGGATGAGGTGCAGATGATTGTGGTGGAACCTGGCAAGAA
    CGTTAAGAACGTCCAGACGAAACCAGGGGTGTTCAAAACACCTGAAGGAGAAATCGGGGCCGTGACTTTG
    GACTTCCCCACTGGAACATCAGGCTCACCAATAGTGGACAAAAACGGTGATGTGATTGGGCTTTATGGCA
    ATGGAGTCATAATGCCCAACGGCTCATACATAAGCGCGATAGTGCAGGGTGAAAGGATGGATGAGCCAAT
    CCCAGCCGGATTCGAACCTGAGATGCTGAGGAAAAAACAGATCACTGTACTGGATCTCCATCCCGGCGCC
    GGTAAAACAAGGAGGATTCTGCCACAGATCATCAAAGAGGCCATAAACAGAAGACTGAGAACAGCCGTGC
    TAGCGCCAACCAGGGTTGTGGCTGCTGAGATGGCTGAAGCACTGAGAGGACTGCCCATCCGGTACCAGAC
    ATCCGCAGTGCCCAGAGAACATAATGGAAATGAGATTGTTGATGTCATGTGTCATGCTACCCTCACCCAC
    AGGCTGATGTCTCCTCACAGGGTGCCGAACTACAACCTGTTCGTGATGGATGAGGCTCATTTCACCGACC
    CAGCTAGCATTGCAGCAAGAGGTTACATTTCCACAAAGGTCGAGCTAGGGGAGGCGGCGGCAATATTCAT
    GACAGCCACCCCACCAGGCACTTCAGATCCATTCCCAGAGTCCAATTCACCAATTTCCGACTTACAGACT
    GAGATCCCGGATCGAGCTTGGAACTCTGGATACGAATGGATCACAGAATACACCGGGAAGACGGTTTGGT
    TTGTGCCTAGTGTCAAGATGGGGAATGAGATTGCCCTTTGCCTACAACGTGCTGGAAAGAAAGTAGTCCA
    ATTGAACAGAAAGTCGTACGAGACGGAGTACCCAAAATGTAAGAACGATGATTGGGACTTTGTTATCACA
    ACAGACATATCTGAAATGGGGGCTAACTTCAAGGCGAGCAGGGTGATTGACAGCCGGAAGAGTGTGAAAC
    CAACCATCATAACAGAAGGAGAAGGGAGAGTGATCCTGGGAGAACCATCTGCAGTGACAGCAGCTAGTGC
    CGCCCAGAGACGTGGACGTATCGGTAGAAATCCGTCGCAAGTTGGTGATGAGTACTGTTATGGGGGGCAC
    ACGAATGAAGACGACTCGAACTTCGCCCATTGGACTGAGGCACGAATCATGCTGGACAACATCAACATGC
    CAAACGGACTGATCGCTCAATTCTACCAACCAGAGCGTGAGAAGGTATATACCATGGATGGGGAATACCG
    GCTCAGAGGAGAAGAGAGAAAAAACTTTCTGGAACTGTTGAGGACTGCAGATCTGCCAGTTTGGCTGGCT
    TACAAGGTTGCAGCGGCTGGAGTGTCATACCACGACCGGAGGTGGTGCTTTGATGGTCCTAGGACAAACA
    CAATTTTAGAAGACAACAACGAAGTGGAAGTCATCACGAAGCTTGGTGAAAGGAAGATTCTGAGGCCGCG
    CTGGATTGATGCCAGGGTGTACTCGGATCACCAGGCACTAAAGGCGTTCAAGGACTTCGCCTCGGGAAAA
    CGTTCTCAGATAGGGCTCATTGAGGTTCTGGGAAAGATGCCTGAGCACTTCATGGGGAAGACATGGGAAG
    CACTTGACACCATGTACGTTGTGGCCACTGCAGAGAAAGGAGGAAGAGCTCACAGAATGGCCCTGGAGGA
    ACTGCCAGATGCTCTTCAGACAATTGCCTTGATTGCCTTATTGAGTGTGATGACCATGGGAGTATTCTTC
    CTCCTCATGCAGCGGAAGGGCATTGGAAAGATAGGTTTGGGAGGCGCTGTCTTGGGAGTCGCGACCTTTT
    TCTGTTGGATGGCTGAAGTTCCAGGAACGAAGATCGCCGGAATGTTGCTGCTCTCCCTTCTCTTGATGAT
    TGTGCTAATTCCTGAGCCAGAGAAGCAACGTTCGCAGACAGACAACCAGCTAGCCGTGTTCCTGATTTGT
    GTCATGACCCTTGTGAGCGCAGTGGCAGCCAACGAGATGGGTTGGCTAGATAAGACCAAGAGTGACATAA
    GCAGTTTGTTTGGGCAAAGAATTGAGGTCAAGGAGAATTTCAGCATGGGAGAGTTTCTTCTGGACTTGAG
    GCCGGCAACAGCCTGGTCACTGTACGCTGTGACAACAGCGGTCCTCACTCCACTGCTAAAGCATTTGATC
    ACGTCAGATTACATCAACACCTCATTGACCTCAATAAACGTTCAGGCAAGTGCACTATTCACACTCGCGC
    GAGGCTTCCCCTTCGTCGATGTTGGAGTGTCGGCTCTCCTGCTAGCAGCCGGATGCTGGGGACAAGTCAC
    CCTCACCGTTACGGTAACAGCGGCAACACTCCTTTTTTGCCACTATGCCTACATGGTTCCCGGTTGGCAA
    GCTGAGGCAATGCGCTCAGCCCAGCGGCGGACAGCGGCCGGAATCATGAAGAACGCTGTAGTGGATGGCA
    TCGTGGCCACGGACGTCCCAGAATTAGAGCGCACCACACCCATCATGCAGAAGAAAGTTGGACAGATCAT
    GCTGATCTTGGTGTCTCTAGCTGCAGTAGTAGTGAACCCGTCTGTGAAGACAGTACGAGAAGCCGGAATT
    TTGATCACGGCCGCAGCGGTGACGCTTTGGGAGAATGGAGCAAGCTCTGTTTGGAACGCAACAACTGCCA
    TCGGACTCTGCCACATCATGCGTGGGGGTTGGTTGTCATGTCTATCCATAACATGGACACTCATAAAGAA
    CATGGAAAAACCAGGACTAAAAAGAGGTGGGGCAAAAGGACGCACCTTGGGAGAGGTTTGGAAAGAAAGA
    CTCAACCAGATGACAAAAGAAGAGTTCACTAGGTACCGCAAAGAGGCCATCATCGAAGTCGATCGCTCAG
    CGGCAAAACACGCCAGGAAAGAAGGCAATGTCACTGGAGGGCATCCAGTCTCTAGGGGCACAGCAAAACT
    GAGATGGCTGGTCGAACGGAGGTTTCTCGAACCGGTCGGAAAAGTGATTGACCTTGGATGTGGAAGAGGC
    GGTTGGTGTTACTATATGGCAACCCAAAAAAGAGTCCAAGAAGTCAGAGGGTACACAAAGGGCGGTCCCG
    GACATGAAGAGCCCCAACTAGTGCAAAGTTATGGATGGAACATTGTCACCATGAAGAGTGGAGTGGATGT
    GTTCTACAGACCTTCTGAGTGTTGTGACACCCTCCTTTGTGACATCGGAGAGTCCTCGTCAAGTGCTGAG
    GTTGAAGAGCATAGGACGATTCGGGTCCTTGAAATGGTTGAGGACTGGCTGCACCGAGGGCCAAGGGAAT
    TTTGCGTGAAGGTGCTCTGTCCCTACATGCCGAAAGTCATAGAGAAGATGGAGCTGCTCCAACGCCGGTA
    TGGGGGGGGACTGGTCAGAAACCCACTCTCACGGAATTCCACGCACGAGATGTATTGGGTGAGTCGAGCT
    TCAGGCAATGTGGTACATTCAGTGAATATGACCAGCCAGGTGCTCCTAGGAAGAATGGAAAAAAGGACCT
    GGAAGGGACCCCAATACGAGGAAGATGTAAACTTGGGAAGTGGAACCAGGGCGGTGGGAAAACCCCTGCT
    CAACTCAGACACCAGTAAAATCAAGAACAGGATTGAACGACTCAGGCGTGAGTACAGTTCGACGTGGCAC
    CACGATGAGAACCACCCATATAGAACCTGGAACTATCACGGCAGTTATGATGTGAAGCCCACAGGCTCCG
    CCAGTTCGCTGGTCAATGGAGTGGTCAGGCTCCTCTCAAAACCATGGGACACCATCACGAATGTTACCAC
    CATGGCCATGACTGACACTACTCCCTTCGGGCAGCAGCGAGTGTTCAAAGAGAAGGTGGACACGAAAGCT
    CCTGAACCGCCAGAAGGAGTGAAGTACGTGCTCAACGAGACCACCAACTGGTTGTGGGCGTTTTTGGCCA
    GAGAAAAACGTCCCAGAATGTGCTCTCGAGAGGAATTCATAAGAAAGGTCAACAGCAATGCAGCTTTGGG
    TGCCATGTTTGAAGAGCAGAATCAATGGAGGAGCGCCAGAGAAGCAGTTGAAGATCCAAAATTTTGGGAG
    ATGGTGGATGAGGAGCGCGAGGCACATCTGCGGGGGGAATGTCACACTTGCATTTACAACATGATGGGAA
    AGAGAGAGAAAAAACCCGGAGAGTTCGGAAAGGCCAAGGGAAGCAGAGCCATTTGGTTCATGTGGCTCGG
    AGCTCGCTTTCTGGAGTTCGAGGCTCTGGGTTTTCTCAATGAAGACCACTGGCTTGGAAGAAAGAACTCA
    GGAGGAGGTGTCGAGGGCTTGGGCCTCCAAAAACTGGGTTACATCCTGCGTGAAGTTGGCACCCGGCCTG
    GGGGCAAGATCTATGCTGATGACACAGCTGGCTGGGACACCCGCATCACGAGAGCTGACTTGGAAAATGA
    AGCTAAGGTGCTTGAGCTGCTTGATGGGGAACATCGGCGTCTTGCCAGGGCCATCATTGAGCTCACCTAT
    CGTCACAAAGTTGTGAAAGTGATGCGCCCGGCTGCTGATGGAAGAACCGTCATGGATGTTATCTCCAGAG
    AAGATCAGAGGGGGAGTGGACAAGTTGTCACCTACGCCCTAAACACTTTCACCAACCTGGCCGTCCAGCT
    GGTGAGGATGATGGAAGGGGAAGGAGTGATTGGCCCAGATGATGTGGAGAAACTCACAAAAGGGAAAGGA
    CCCAAAGTCAGGACCTGGCTGTTTGAGAATGGGGAAGAAAGACTCAGCCGCATGGCTGTCAGTGGAGATG
    ACTGTGTGGTAAAGCCCCTGGACGATCGCTTTGCCACCTCGCTCCACTTCCTCAATGCTATGTCAAAGGT
    TCGCAAAGACATCCAAGAGTGGAAACCGTCAACTGGATGGTATGATTGGCAGCAGGTTCCATTTTGCTCA
    AACCATTTCACTGAATTGATCATGAAAGATGGAAGAACACTGGTGGTTCCATGCCGAGGACAGGATGAAT
    TGGTAGGCAGAGCTCGCATATCTCCAGGGGCCGGATGGAACGTCCGCGACACTGCTTGTCTGGCTAAGTC
    TTATGCCCAGATGTGGCTGCTTCTGTACTTCCACAGAAGAGACCTGCGGCTCATGGCCAACGCCATTTGC
    TCCGCTGTCCCTGTGAATTGGGTCCCTACCGGAAGAACCACGTGGTCCATCCATGCAGGAGGAGAGTGGA
    TGACAACAGAGGACATGTTGGAGGTCTGGAACCGTGTTTGGATAGAGGAGAATGAATGGATGGAAGACAA
    AACCCCAGTGGAGAAATGGAGTGACGTCCCATATTCAGGAAAACGAGAGGACATCTGGTGTGGCAGCCTG
    ATTGGCACAAGAGCCCGAGCCACGTGGGCAGAAAACATCCAGGTGGCTATCAACCAAGTCAGAGCAATCA
    TCGGAGATGAGAAGTATGTGGACTACATGAGTTCACTAAAGAGATATGAAGACACAACTTTGGTTGAGGA
    CACAGTACTGTA
  • Protein Sequence : Show Sequence
    >gi|158516888|ref|YP_001527877.1| polyprotein [West Nile virus]
    MSKKPGGPGKSRAVNMLKRGMPRVLSLIGLKRAMLSLIDGKGPIRFVLALLAFFRFTAIAPTRAVLDRWR
    GVNKQTAMKHLLSFKKELGTLTSAINRRSSKQKKRGGKTGIAVMIGLIASVGAVTLSNFQGKVMMTVNAT
    DVTDVITIPTAAGKNLCIVRAMDVGYMCDDTITYECPVLSAGNDPEDIDCWCTKSAVYVRYGRCTKTRHS
    RRSRRSLTVQTHGESTLANKKGAWMDSTKATRYLVKTESWILRNPGYALVAAVIGWMLGSNTMQRVVFVV
    LLLLVAPAYSFNCLGMSNRDFLEGVSGATWVDLVLEGDSCVTIMSKDKPTIDVKMMNMEAANLAEVRSYC
    YLATVSDLSTKAACPTMGEAHNDKRADPAFVCRQGVVDRGWGNGCGLFGKGSIDTCAKFACSTKAIGRTI
    LKENIKYEVAIFVHGPTTVESHGNYSTQVGATQAGRLSITPAAPSYTLKLGEYGEVTVDCEPRSGIDTNA
    YYVMTVGTKTFLVHREWFMDLNLPWSSAGSTVWRNRETLMEFEEPHATKQSVIALGSQEGALHQALAGAI
    PVEFSSNTVKLTSGHLKCRVKMEKLQLKGTTYGVCSKAFKFLGTPADTGHGTVVLELQYTGTDGPCKVPI
    SSVASLNDLTPVGRLVTVNPFVSVATANAKVLIELEPPFGDSYIVVGRGEQQINHHWHKSGSSIGKAFTT
    TLKGAQRLAALGDTAWDFGSVGGVFTSVGKAVHQVFGGAFRSLFGGMSWITQGLLGALLLWMGINARDRS
    IALTFLAVGGVLLFLSVNVHADTGCAIDISRQELRCGSGVFIHNDVEAWMDRYKYYPETPQGLAKIIQKA
    HKEGVCGLRSVSRLEHQMWEAVKDELNTLLKENGVDLSVVVEKQEGMYKSAPKRLTATTEKLEIGWKAWG
    KSILFAPELANNTFVVDGPETKECPTQNRAWNSLEVEDFGFGLTSTRMFLKVRESNTTECDSKIIGTAVK
    NNLAIHSDLSYWIESRLNDTWKLERAVLGEVKSCTWPETHTLWGDGILESDLIIPVTLAGPRSNHNRRPG
    YKTQNQGPWDEGRVEIDFDYCPGTTVTLSESCGHRGPATRTTTESGKLITDWCCRSCTLPPLRYQTDSGC
    WYGMEIRPQRHDEKTLVQSQVNAYNADMIDPFQLGLLVVFLATQEVLRKRWTAKISMPAILIALLVLVFG
    GITYTDVLRYVILVGAAFAESNSGGDVVHLALMATFKIQPVFMVASFLKARWTNQENILLMLAAVFFQMA
    YHDARQILLWEIPDVLNSLAVAWMILRAITFTTTSNVVVPLLALLTPGLRCLNLDVYRILLLMVGIGSLI
    REKRSAAAKKKGASLLCLALASTGLFNPMILAAGLIACDPNRKRGWPATEVMTAVGLMFAIVGGLAELDI
    DSMAIPMTIAGLMFAAFVISGKSTDMWIERTADISWESDAEITGSSERVDVRLDDDGNFQLMNDPGAPWK
    IWMLRMVCLAISAYTPWAILPSVVGFWITLQYTKRGGVLWDTPSPKEYKKGDTTTGVYRIMTRGLLGSYQ
    AGAGVMVEGVFHTLWHTTKGAALMSGEGRLDPYWGSVKEDRLCYGGPWKLQHKWNGQDEVQMIVVEPGKN
    VKNVQTKPGVFKTPEGEIGAVTLDFPTGTSGSPIVDKNGDVIGLYGNGVIMPNGSYISAIVQGERMDEPI
    PAGFEPEMLRKKQITVLDLHPGAGKTRRILPQIIKEAINRRLRTAVLAPTRVVAAEMAEALRGLPIRYQT
    SAVPREHNGNEIVDVMCHATLTHRLMSPHRVPNYNLFVMDEAHFTDPASIAARGYISTKVELGEAAAIFM
    TATPPGTSDPFPESNSPISDLQTEIPDRAWNSGYEWITEYTGKTVWFVPSVKMGNEIALCLQRAGKKVVQ
    LNRKSYETEYPKCKNDDWDFVITTDISEMGANFKASRVIDSRKSVKPTIITEGEGRVILGEPSAVTAASA
    AQRRGRIGRNPSQVGDEYCYGGHTNEDDSNFAHWTEARIMLDNINMPNGLIAQFYQPEREKVYTMDGEYR
    LRGEERKNFLELLRTADLPVWLAYKVAAAGVSYHDRRWCFDGPRTNTILEDNNEVEVITKLGERKILRPR
    WIDARVYSDHQALKAFKDFASGKRSQIGLIEVLGKMPEHFMGKTWEALDTMYVVATAEKGGRAHRMALEE
    LPDALQTIALIALLSVMTMGVFFLLMQRKGIGKIGLGGAVLGVATFFCWMAEVPGTKIAGMLLLSLLLMI
    VLIPEPEKQRSQTDNQLAVFLICVMTLVSAVAANEMGWLDKTKSDISSLFGQRIEVKENFSMGEFLLDLR
    PATAWSLYAVTTAVLTPLLKHLITSDYINTSLTSINVQASALFTLARGFPFVDVGVSALLLAAGCWGQVT
    LTVTVTAATLLFCHYAYMVPGWQAEAMRSAQRRTAAGIMKNAVVDGIVATDVPELERTTPIMQKKVGQIM
    LILVSLAAVVVNPSVKTVREAGILITAAAVTLWENGASSVWNATTAIGLCHIMRGGWLSCLSITWTLIKN
    MEKPGLKRGGAKGRTLGEVWKERLNQMTKEEFTRYRKEAIIEVDRSAAKHARKEGNVTGGHPVSRGTAKL
    RWLVERRFLEPVGKVIDLGCGRGGWCYYMATQKRVQEVRGYTKGGPGHEEPQLVQSYGWNIVTMKSGVDV
    FYRPSECCDTLLCDIGESSSSAEVEEHRTIRVLEMVEDWLHRGPREFCVKVLCPYMPKVIEKMELLQRRY
    GGGLVRNPLSRNSTHEMYWVSRASGNVVHSVNMTSQVLLGRMEKRTWKGPQYEEDVNLGSGTRAVGKPLL
    NSDTSKIKNRIERLRREYSSTWHHDENHPYRTWNYHGSYDVKPTGSASSLVNGVVRLLSKPWDTITNVTT
    MAMTDTTPFGQQRVFKEKVDTKAPEPPEGVKYVLNETTNWLWAFLAREKRPRMCSREEFIRKVNSNAALG
    AMFEEQNQWRSAREAVEDPKFWEMVDEEREAHLRGECHTCIYNMMGKREKKPGEFGKAKGSRAIWFMWLG
    ARFLEFEALGFLNEDHWLGRKNSGGGVEGLGLQKLGYILREVGTRPGGKIYADDTAGWDTRITRADLENE
    AKVLELLDGEHRRLARAIIELTYRHKVVKVMRPAADGRTVMDVISREDQRGSGQVVTYALNTFTNLAVQL
    VRMMEGEGVIGPDDVEKLTKGKGPKVRTWLFENGEERLSRMAVSGDDCVVKPLDDRFATSLHFLNAMSKV
    RKDIQEWKPSTGWYDWQQVPFCSNHFTELIMKDGRTLVVPCRGQDELVGRARISPGAGWNVRDTACLAKS
    YAQMWLLLYFHRRDLRLMANAICSAVPVNWVPTGRTTWSIHAGGEWMTTEDMLEVWNRVWIEENEWMEDK
    TPVEKWSDVPYSGKREDIWCGSLIGTRARATWAENIQVAINQVRAIIGDEKYVDYMSSLKRYEDTTLVED
    TVL
  • Molecule Role : Other
2. Envelope protein
  • Gene Name : Envelope protein
  • Sequence Strain (Species/Organism) : Japanese encephalitis virus
  • VO ID : VO_0011145
  • NCBI Protein GI : 16445023
  • Other Database IDs : CDD:109907
    CDD:145801
  • Taxonomy ID : 11072
  • Gene Strand (Orientation) : ?
  • Protein Name : envelope protein
  • Protein Length : 500
  • Protein Note : Flavivirus glycoprotein, central and dimerization domains; pfam00869
  • Protein Sequence : Show Sequence
    >gi|16445023|gb|AAK31640.1| envelope protein [Japanese encephalitis virus]
    FNCLGMGNRDFIEGASGATWVDLVLEGDSCLTIMANDKPTLDVRMINIEASQLAEVRSYCYHASVTDIST
    VARCPTTGEAHNEKRADSSYVCKQGFTDRGWGNGCGLFGKGSIDTCAKFSCTSKAIGRTIQPENIKYKVG
    IFVHGATTSENHGNYSAQVGASQAAKFTVTPNAPSITLKLGDYGEVTLDCEPRSGLNTEAFYVMTVGSKS
    FLVHREWFHDLALPWTSPSSTAWRNRELLMEFEEAHATKQSVVALGSQEGGLHQALAGAIVVEYSSSVKL
    TSGHLKCRLKMDKLALKGTTYGMCTEKFSFAKNPADTGHGTVVIELSYSGSDGPCKIPIVSVASLNDMTP
    VGRLVTVNPFVATSSANSKVLVEMEPPFGDSYIVVGRGDKQINHHWHKAGSTLGKAFSTTLKGAQRLAAL
    GDTAWDFGSIGGVFNSIGKAVHQVFGGAFRTLFGGMSWITQGLMGALLLWMGVNARDRSIALAFLATGGV
    LVFLATNVHA
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Researchers constructed a recombinant pseudotype baculovirus encoding the JEV envelope (E) protein and demonstrated that it could elicit high protective immunity in mice. Intramuscular injections of BV-G-E at various doses into mice produced higher levels of JEV-specific neutralizing antibodies, IFN-gamma and better protective efficacy against a lethal challenge with JEV than that of pc-E. Furthermore, BV-G-E could elicit a higher level of cellular immunity response and provide equal protective efficacy against JEV challenge compared to inactivated vaccine (Li et al., 2009).
  • Related Vaccine(s): Japanese encephalitis virus DNA vaccine encoding E protein , Japanese encephalitis virus DNA Vaccine P-JEV , Japanese encephalitis virus DNA Vaccine pCJ-3/E encoding E , Japanese encephalitis virus vaccine BV-G-E , NYVAC-JEV- prM/E/ NS1
3. M protein
  • Gene Name : M protein
  • Sequence Strain (Species/Organism) : Japanese encephalitis virus strain TS3306
  • NCBI Protein GI : 4572323
  • Other Database IDs : CDD:110567
  • Taxonomy ID : 11072
  • Gene Strand (Orientation) : ?
  • Protein Name : M protein
  • Protein Length : 92
  • Protein Note : isolated from the Torres Strait
  • Protein Sequence : Show Sequence
    >gi|4572323|gb|AAD23744.1|AF092939_1 M protein [Japanese encephalitis virus]
    MKLSNFQGKLLMTVNNTDIADVIVIPTSKGENRCWVRAIDVGYMCEDTITYECPKLTTGNDPEDVDCWCD
    NQEVYIQYGRCTRTRHSKRSRR
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Japanese encephalitis virus DNA Vaccine P-JEV
4. NS1
  • Gene Name : NS1
  • Sequence Strain (Species/Organism) : Japanese encephalitis virus
  • VO ID : VO_0011147
  • NCBI Protein GI : 18418672
  • Other Database IDs : CDD:109983
    CDD:144553
  • Taxonomy ID : 11072
  • Gene Strand (Orientation) : ?
  • Protein Name : NS1 protein
  • Protein Length : 151
  • Protein Note : isolated from porcine sera
  • Protein Sequence : Show Sequence
    >gi|18418672|gb|AAL68990.1| NS1 protein [Japanese encephalitis virus]
    ELIIPHTIAGPRSKHNRREGYKTQNQGPWDENGIVLDFDYCPGTKVTITEDCGKRGPSIRTTTDSGKLIT
    DWCCRSCSLPPLRFRTENGCWYGMEIRPVRHDETTLVRSQVDAFNGEMIDPFQLGLLVMFLATQEVLRKR
    WTARLTIPAVL
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Balb/c mice and swine vaccinated with TK(-)/gG(-)/NS1(+) expressing NS1 protein of JEV could confer protective immunity against lethal challenge of the virulent PRV Ea strain and develop a good humoral and cellular immune response against JEV (Xu et al., 2004).
  • Related Vaccine(s): Japanese encephalitis virus DNA vaccine encoding NS1 (pUSK-NS1) , Japanese encephalitis virus DNA Vaccine P-JEV , NYVAC-JEV- prM/E/ NS1
5. NS3
  • Gene Name : NS3
  • Sequence Strain (Species/Organism) : Japanese encephalitis virus
  • VO ID : VO_0011148
  • NCBI Protein GI : 27696332
  • Other Database IDs : CDD:144519
    CDD:28927
    CDD:28960
  • Taxonomy ID : 11072
  • Gene Strand (Orientation) : ?
  • Protein Name : non-structural protein NS3
  • Protein Length : 619
  • Protein Note : proteinase and putative helicase
  • Protein Sequence : Show Sequence
    >gi|27696332|ref|NP_775670.1| non-structural protein NS3 [Japanese encephalitis virus]
    GGVFWDTPSPKPCSKGDTTTGVYRIMARGILGTYQAGVGVMYENVFHTLWHTTRGAAIMSGEGKLTPYWG
    SVKEDRIAYGGPWRFDRKWNGTDDVQVIVVEPGKAAVNIQTKPGVFRTPFGEVGAVSLDYPRGTSGSPIL
    DSNGDIIGLYGNGVELGDGSYVSAIVQGDRQEEPVPEAYTPNMLRKRQMTVLDLHPGSGKTRKILPQIIK
    DAIQQRLRTAVLAPTRVVAAEMAEALRGLPVRYQTSAVQREHQGNEIVDVMCHATLTHRLMSPNRVPNYN
    LFVMDEAHFTDPASIAARGYIATKVELGEAAAIFMTATPPGTTDPFPDSNAPIHDLQDEIPDRAWSSGYE
    WITEYAGKTVWFVASVKMGNEIAMCLQRAGKKVIQLNRKSYDTEYPKCKNGDWDFVITTDISEMGANFGA
    SRVIDCRKSVKPTILEEGEGRVILGNPSPITSASAAQRRGRVGRNPNQVGDEYHYGGATSEDDSNLAHWT
    EAKIMLDNIHMPNGLVAQLYGPEREKAFTMDGEYRLRGEEKKNFLELLRTADLPVWLAYKVASNGIQYTD
    RRWCFDGPRTNAILEDNTEVEIVTRMGERKILKPRWLDARVYADHQALKWFKDFAAGKR
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Researchers constructed plasmid DNAs encoding JE virus proteins. Cytotoxic T lymphocytes (CTLs) were induced by NS3 in a mouse model. Three immunizations with pUJENS3 provided a 50% partial protection from a lethal dose of JE virus (Konishi et al., 2003).
  • Related Vaccine(s): Japanese encephalitis virus DNA vaccine pUJENS3
6. NS5
  • Gene Name : NS5
  • Sequence Strain (Species/Organism) : Japanese encephalitis virus
  • VO ID : VO_0011149
  • NCBI Protein GI : 158702649
  • Other Database IDs : CDD:110005
  • Taxonomy ID : 11072
  • Gene Strand (Orientation) : ?
  • Protein Name : NS5
  • Protein Length : 77
  • Protein Note : Flavivirus RNA-directed RNA polymerase; pfam00972
  • Protein Sequence : Show Sequence
    >gi|158702649|gb|ABW77689.1| NS5 [Japanese encephalitis virus]
    KREKKPGEFGKAKGSRAIWFMWLGARYLEFEALGFLNEDHWLSRENSGGGVEGSGVQKLGYILRDIAGKQ
    GGKMYAD
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Researchers constructed plasmid DNAs encoding JE virus proteins. Cytotoxic T lymphocytes (CTLs) were induced by NS5 in a mouse model. Three immunizations with pUJENS5 provided a 57% partial protection from a lethal dose of JE virus (Konishi et al., 2003).
  • Related Vaccine(s): Japanese encephalitis virus DNA vaccine pUJENS5
7. PreM
  • Gene Name : PreM
  • Sequence Strain (Species/Organism) : Japanese encephalitis virus
  • VO ID : VO_0011150
  • NCBI Protein GI : 14600066
  • Other Database IDs : CDD:110567
    CDD:110035
  • Taxonomy ID : 11072
  • Gene Strand (Orientation) : ?
  • Protein Name : preM protein
  • Protein Length : 167
  • Protein Note : Flavivirus polyprotein propeptide; pfam01570
  • Protein Sequence : Show Sequence
    >gi|14600066|gb|AAK71232.1| preM protein [Japanese encephalitis virus]
    MKLSNFQGKLLMTINNTDIADVIVIPTSKGENRCWVRAIDVGYMCEDTITYECPKLTMGNDPEDVDCWCD
    NQEVYVQYGRCTRTRHSKRSRRSVSVQTHGESSLVNKKEAWLDSTKATRYLMKTENWIIRNPGYAFLAAA
    LGWMLGSNNGQRVVFTILLLLVAPAYS
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : A cDNA clone representing the genome of structural proteins of Japanese encephalitis virus (JEV) was inserted into the thymidine kinase gene of vaccinia virus strains LC16mO and WR. Inoculation of rabbits with the infectious recombinant vaccinia virus resulted in rapid production of antiserum specific for the PreM and E glycoproteins of JEV. Mice vaccinated with the recombinant produced JEV-neutralizing antibodies and were resistant to challenge with JEV (Yasuda et al., 1990).
8. PrM
  • Gene Name : PrM
  • Sequence Strain (Species/Organism) : Japanese encephalitis virus
  • VO ID : VO_0011146
  • NCBI Protein GI : 90019439
  • Other Database IDs : CDD:110567
  • Taxonomy ID : 11072
  • Gene Strand (Orientation) : ?
  • Protein Name : PrM
  • Protein Length : 80
  • Protein Note : Flavivirus polyprotein propeptide; pfam01570
  • Protein Sequence : Show Sequence
    >gi|90019439|gb|ABD84370.1| PrM [Japanese encephalitis virus]
    VIACVGAMKLSNFQGKLLMTINKTDIADVIVIPTSKGENRCWVRAIDVGYMCEDTITYECPKLTMGNDPE
    DVDCWCDNQE
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Researchers established a simple and effective method for DNA immunization against Japanese encephalitis virus (JEV) infection with plasmids encoding the viral PrM and E proteins and colloidal gold. After being inoculated twice, BALB/c mice were found to resist challenge with 100,000 times the 50% lethal dose (LD(50)) of JEV (Beijing-1 strain) even when immunized with a relatively small dose of 0.5 micro g of plasmid DNA (Zhao et al., 2003).
  • Related Vaccine(s): Japanese encephalitis virus DNA vaccine encoding E protein , Japanese encephalitis virus DNA vaccine encoding PrM , NYVAC-JEV- prM/E/ NS1
9. PrM from West Nile Virus
  • Gene Name : PrM from West Nile Virus
  • Sequence Strain (Species/Organism) : West Nile virus NY99
  • NCBI Protein GI : 158516890
  • Other Database IDs : CDD:110567
    CDD:201546
    VBRC:36388
  • Taxonomy ID : 11082
  • Gene Strand (Orientation) : ?
  • Protein Name : prM protein
  • Protein Length : 167
  • Protein Note : lineage 1; Vero cell passage 2 after isolation
  • Protein Sequence : Show Sequence
    >gi|158516890|ref|YP_001527879.1| unnamed protein product [West Nile virus]
    VTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRAMDVGYMCDDTITYECPVLSAGNDPEDIDCWCT
    KSAVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWMDSTKATRYLVKTESWILRNPGYALVAAV
    IGWMLGSNTMQRVVFVVLLLLVAPAYS
  • Molecule Role : Other
1. Ifng (Interferon gamma)
  • Gene Name : Ifng (Interferon gamma)
  • Sequence Strain (Species/Organism) : Mouse
  • NCBI Gene ID : 15978
  • NCBI Protein GI : 33468859
  • Genbank Accession : NM_008337
  • Protein Accession : NP_032363.1
  • Other Database IDs : MGI:107656; UniProt: P01580
  • Taxonomy ID : 10090
  • Gene Strand (Orientation) : ?
  • DNA Sequence : Show Sequence
    >gi|145966741|ref|NM_008337.3| Mus musculus interferon gamma (Ifng), mRNA
    ATAGCTGCCATCGGCTGACCTAGAGAAGACACATCAGCTGATCCTTTGGACCCTCTGACTTGAGACAGAA
    GTTCTGGGCTTCTCCTCCTGCGGCCTAGCTCTGAGACAATGAACGCTACACACTGCATCTTGGCTTTGCA
    GCTCTTCCTCATGGCTGTTTCTGGCTGTTACTGCCACGGCACAGTCATTGAAAGCCTAGAAAGTCTGAAT
    AACTATTTTAACTCAAGTGGCATAGATGTGGAAGAAAAGAGTCTCTTCTTGGATATCTGGAGGAACTGGC
    AAAAGGATGGTGACATGAAAATCCTGCAGAGCCAGATTATCTCTTTCTACCTCAGACTCTTTGAAGTCTT
    GAAAGACAATCAGGCCATCAGCAACAACATAAGCGTCATTGAATCACACCTGATTACTACCTTCTTCAGC
    AACAGCAAGGCGAAAAAGGATGCATTCATGAGTATTGCCAAGTTTGAGGTCAACAACCCACAGGTCCAGC
    GCCAAGCATTCAATGAGCTCATCCGAGTGGTCCACCAGCTGTTGCCGGAATCCAGCCTCAGGAAGCGGAA
    AAGGAGTCGCTGCTGATTCGGGGTGGGGAAGAGATTGTCCCAATAAGAATAATTCTGCCAGCACTATTTG
    AATTTTTAAATCTAAACCTATTTATTAATATTTAAAACTATTTATATGGAGAATCTATTTTAGATGCATC
    AACCAAAGAAGTATTTATAGTAACAACTTATATGTGATAAGAGTGAATTCCTATTAATATATGTGTTATT
    TATAATTTCTGTCTCCTCAACTATTTCTCTTTGACCAATTAATTATTCTTTCTGACTAATTAGCCAAGAC
    TGTGATTGCGGGGTTGTATCTGGGGGTGGGGGACAGCCAAGCGGCTGACTGAACTCAGATTGTAGCTTGT
    ACCTTTACTTCACTGACCAATAAGAAACATTCAGAGCTGCAGTGACCCCGGGAGGTGCTGCTGATGGGAG
    GAGATGTCTACACTCCGGGCCAGCGCTTTAACAGCAGGCCAGACAGCACTCGAATGTGTCAGGTAGTAAC
    AGGCTGTCCCTGAAAGAAAGCAGTGTCTCAAGAGACTTGACACCTGGTGCTTCCCTATACAGCTGAAAAC
    TGTGACTACACCCGAATGACAAATAACTCGCTCATTTATAGTTTATCACTGTCTAATTGCATATGAATAA
    AGTATACCTTTGCAACC
  • Protein Sequence : Show Sequence
    >gi|33468859|ref|NP_032363.1| interferon gamma [Mus musculus]
    MNATHCILALQLFLMAVSGCYCHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQI
    ISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQ
    LLPESSLRKRKRSRC
  • Molecule Role Annotation : IFN-gamma plays a critical role in Th1 type immune response. It is important for protection against infections by various viruses and intracellular bacteria.
  • Additional Molecule Role : Vaximmutor
  • Additional Molecule Role Annotation : The experimental data demonstrated that three time vaccinations with BCG in BALB/c mice induced strong TB Ag-specific IFN-gamma immune responses in splenocytes (Wang et al., 2009).
  • Related Vaccine(s): Japanese encephalitis virus vaccine BV-G-E
IV. Vaccine Information
1. ALVAC-JEV
a. Vaccine Ontology ID:
VO_0004777
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Preparation
Poxvirus-vectored vaccines for Japanese encephalitis (JE), NYVAC-JEV and ALVAC-JEV(Raengsakulrach et al., 1999).
f. Immunization Route
Intramuscular injection (i.m.)
g. Monkey Response
  • Vaccination Protocol: The vaccines were given to four monkeys each on study days 0 and 28 along with saline placebo on day 7. For controls, the licensed BIKEN JE vaccine and a saline placebo were given to other groups of four monkeys on days 0, 7, and 28 (Raengsakulrach et al., 1999).
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: Two months after the booster dose, all 16 monkeys were challenged intranasally with one 90% effective dose of JEV strain KE-93 (AP61-1, C6/36-1, Mm-1, SM-2) (Raengsakulrach et al., 1999).
  • Efficacy: This study suggests that the NYVAC-JEV and ALVAC-JEV vaccines are safe and immunogenic in monkeys and that the NYVAC-JEV and BIKEN vaccines are effective in protecting monkeys from encephalitis (Raengsakulrach et al., 1999).
2. Ixiaro
a. Product Name:
Japanese Encephalitis Vaccine, Inactivated, Adsorbed
b. Tradename:
IXIARO
c. Manufacturer:
Valneva SE
d. Vaccine Ontology ID:
VO_0011558
e. CDC CVX code:
134
f. Type:
Inactivated or "killed" vaccine
g. Status:
Licensed
h. Location Licensed:
USA, Canada
i. Host Species for Licensed Use:
Human
j. Adjuvant: aluminum hydroxide vaccine adjuvant
k. Preparation
JEV strain SA14-14-2 is propagated in Vero cells, and harvested. The harvested virus suspension is treated with protamine sulfate to remove contaminating DNA and proteins and centrifuged. Virus is inactivated by formaldehyde and aluminum hydroxide is added Ref917:FDA: Ixiaro].
l. Immunization Route
Intramuscular injection (i.m.)
m. Storage
Store in a refrigerator at 2° to 8° C (35° to 46° F). Do not freeze.
n . Approved Age for Licensed Use
2 months of age and older
3. Japanese encephalitis virus (JEV)
a. Type:
Recombinant vector vaccine
b. Status:
Licensed
c. Host Species for Licensed Use:
Baboon
d. Immunization Route
Intramuscular injection (i.m.)
4. Japanese encephalitis virus DNA vaccine encoding E protein
a. Vaccine Ontology ID:
VO_0011353
b. Type:
DNA vaccine
c. Status:
Research
d. Antigen
Japanese encephalitis virus PrM and E protein
e. Gene Engineering of PrM
  • Type: DNA vaccine construction
  • Description: Plasmid pSLKJ12 contains the premembrane signal sequence as well as the premembrane (PrM) and envelope (E) genes of the Sagayama strain of JEV. The viral sequence, spanning nucleotides 408 to 2477, was retrieved from this plasmid by PstI-EcoRI digestion. The fragment was cloned into the eukaryotic expression vectors pcDL-SRα296 and pCAGGS, generously provided by Y. Takebe (Laboratory of Molecular Virology and Epidemiology, AIDS Research Center, National Institute of Infectious Diseases, Shinjuku-ku, Tokyo, Japan) and J. Miyazaki (Division of Stem Cell Regulation Research, G6, Osaka University Medical School, Suita, Osaka, Japan), respectively. They are purified and designated pSRαJ12 and pCAGJ12, respectively (Zhao et al., 2003).
  • Detailed Gene Information: Click here.
f. Gene Engineering of Envelope protein
  • Type: DNA vaccine construction
  • Description: Plasmid pSLKJ12 contains the premembrane signal sequence as well as the premembrane (PrM) and envelope (E) genes of the Sagayama strain of JEV. The viral sequence, spanning nucleotides 408 to 2477, was retrieved from this plasmid by PstI-EcoRI digestion. The fragment was cloned into the eukaryotic expression vectors pcDL-SRα296 and pCAGGS, generously provided by Y. Takebe (Laboratory of Molecular Virology and Epidemiology, AIDS Research Center, National Institute of Infectious Diseases, Shinjuku-ku, Tokyo, Japan) and J. Miyazaki (Division of Stem Cell Regulation Research, G6, Osaka University Medical School, Suita, Osaka, Japan), respectively (Zhao et al., 2003).
  • Detailed Gene Information: Click here.
g. Vector:
Expression vectors pcDL-SRα296 and pCAGGS
h. Immunization Route
Intravenous injection (i.v.)
i. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: For the protection test, 3-week-old female BALB/c mice were inoculated with either 50, 5, or 0.5 μg of the mixture on days 0 and 9 intravenously or intradermally (Zhao et al., 2003).
  • Challenge Protocol: On day 22, all immunized mice were challenged by an intraperitoneal injection of 100,000 times the LD50 of JEV (Beijing-1 strain, 0.15 ml), at which time they were simultaneously inoculated intracerebrally with 25 μl of saline into the right hemisphere of their brains with a 27-gauge one-stop needle (Top Injection Needle, Tokyo, Japan) (Zhao et al., 2003).
  • Efficacy: Researchers established a simple and effective method for DNA immunization against Japanese encephalitis virus (JEV) infection with plasmids encoding the viral PrM and E proteins and colloidal gold. After being inoculated twice, BALB/c mice were found to resist challenge with 100,000 times the 50% lethal dose (LD(50)) of JEV (Beijing-1 strain) even when immunized with a relatively small dose of 0.5 micro g of plasmid DNA (Zhao et al., 2003).
5. Japanese encephalitis virus DNA vaccine encoding NS1 (pUSK-NS1)
a. Vaccine Ontology ID:
VO_0011500
b. Type:
DNA vaccine
c. Status:
Research
d. Antigen
Japanese encephalitis virus NS1
e. Gene Engineering of NS1
  • Type: DNA vaccine construction
  • Description: NS1 gene of Japanese encephalitis virus (JEV) SA14-14-2 strain was produced by reverse transcriptase-mediated PCR (RT-PCR) and was cloned into vector pUSK to form recombinant plasmid (designed as pUSK-NS1) (Xu et al., 2004).
  • Detailed Gene Information: Click here.
f. Vector:
pUSK
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: Ten 6-week-old Balb/c mice and eight 2-days old piglets were immunized with 5.0 log10pfu of the TK−/gG−/NS1+ mutant, while another equal number of animal in control groups with PBS (Xu et al., 2004).
  • Challenge Protocol: The challenge was performed with PRV Ea strain at a concentration of 6.5 log10pfu (LD50=10−4.5) at day 7 for mice and day 14 for piglets post-vaccination (Xu et al., 2004).
  • Efficacy: Balb/c mice and swine vaccinated with TK(-)/gG(-)/NS1(+) expressing NS1 protein of JEV could confer protective immunity against lethal challenge of the virulent PRV Ea strain and develop a good humoral and cellular immune response against JEV (Xu et al., 2004).
6. Japanese encephalitis virus DNA vaccine encoding PrM
a. Vaccine Ontology ID:
VO_0011345
b. Type:
DNA vaccine
c. Status:
Research
d. Antigen
envelope protein
e. Gene Engineering of PrM
  • Type: DNA vaccine construction
  • Description: Plasmid pSLKJ12 contains the premembrane signal sequence as well as the premembrane (PrM) and envelope (E) genes of the Sagayama strain of JEV. The viral sequence, spanning nucleotides 408 to 2477, was retrieved from this plasmid by PstI-EcoRI digestion. The fragment was cloned into the eukaryotic expression vectors pcDL-SRα296 and pCAGGS, generously provided by Y. Takebe (Laboratory of Molecular Virology and Epidemiology, AIDS Research Center, National Institute of Infectious Diseases, Shinjuku-ku, Tokyo, Japan) and J. Miyazaki (Division of Stem Cell Regulation Research, G6, Osaka University Medical School, Suita, Osaka, Japan), respectively. They are purified and designated pSRαJ12 and pCAGJ12, respectively (Zhao et al., 2003).
  • Detailed Gene Information: Click here.
f. Vector:
Expression vectors pcDL-SRα296 and pCAGGS
g. Immunization Route
Intravenous injection (i.v.)
h. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: For the protection test, 3-week-old female BALB/c mice were inoculated with either 50, 5, or 0.5 μg of the mixture on days 0 and 9 intravenously or intradermally (Zhao et al., 2003).
  • Challenge Protocol: On day 22, all immunized mice were challenged by an intraperitoneal injection of 100,000 times the LD50 of JEV (Beijing-1 strain, 0.15 ml), at which time they were simultaneously inoculated intracerebrally with 25 μl of saline into the right hemisphere of their brains with a 27-gauge one-stop needle (Top Injection Needle, Tokyo, Japan) (Zhao et al., 2003).
  • Efficacy: Researchers established a simple and effective method for DNA immunization against Japanese encephalitis virus (JEV) infection with plasmids encoding the viral PrM and E proteins and colloidal gold. After being inoculated twice, BALB/c mice were found to resist challenge with 100,000 times the 50% lethal dose (LD(50)) of JEV (Beijing-1 strain) even when immunized with a relatively small dose of 0.5 micro g of plasmid DNA (Zhao et al., 2003).
7. Japanese encephalitis virus DNA Vaccine P-JEV
a. Vaccine Ontology ID:
VO_0004586
b. Type:
DNA vaccine
c. Status:
Research
d. Gene Engineering of Envelope protein
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
e. Gene Engineering of NS1
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
f. Gene Engineering of M protein
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
g. Vector:
pcDNA3.1/V5-His-P-JEV (Kulkarni et al., 2012)
h. Immunization Route
Intramuscular injection (i.m.)
i. Mouse Response
  • Vaccination Protocol: Control mice received 1 μg of pcDNA3.1/V5-His plasmid per dose. While same amount of recombinant plasmid, pcDNA3.1/V5-His-P-JEV was used to immunize the experimental group. Groups of BALB/c mice (n = 10), received two booster doses with equal amount of DNA after every 2 weeks (Kulkarni et al., 2012).
  • Vaccine Immune Response Type: VO_0003057
  • Immune Response: Anti-JEV antibodies were detectable in all mouse groups 31 days after immunization. Levels of these antibodies increased after the first booster immunization and were further enhanced after the second booster dose. Following the challenge, pcDNA3.1/V5-His-P-JEV immunized mice showed significantly enhanced JEV antibody titres (Kulkarni et al., 2012).
  • Challenge Protocol: At 6 weeks after immunization, mice were challenged with lethal dose of 100LD50 with JEV 733913 strain by intraperitonial route, followed by 1% starch by the intracerebral route to breach the blood brain barrier (Kulkarni et al., 2012).
  • Efficacy: Approximately 83% of mice immunized with the vaccine survived the challenge injection (Kulkarni et al., 2012).
8. Japanese encephalitis virus DNA Vaccine pCJ-3/E encoding E
a. Vaccine Ontology ID:
VO_0004587
b. Type:
DNA vaccine
c. Status:
Research
d. Gene Engineering of Envelope protein
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
e. Vector:
pCJ-3/E (Wu et al., 2006)
f. Immunization Route
Intramuscular injection (i.m.)
g. Mouse Response
  • Vaccination Protocol: All mice were immunized intramuscularly at 6 to 8 weeks of age. Groups of five mice were anesthetized and injected three times at 3-week intervals with 100 μg of DNA (Wu et al., 2006).
  • Vaccine Immune Response Type: VO_0003057
  • Immune Response: The vaccine enhanced the production of higher titers of neutralizing antibodies, and generated both cellular and humoral immunity (Wu et al., 2006).
  • Challenge Protocol: For a lethal challenge experiment, C3H/HeN mice were injected intraperitoneally with 50 times the LD50 of JEV Beijing-1 and intracerebrally with PBS (Wu et al., 2006).
  • Efficacy: In terms of survival rates of immunized mice challenged with JEV virus at week 16, 100% protection was seen with pCJ-3/E-immunized mice (Wu et al., 2006).
9. Japanese encephalitis virus DNA vaccine pUJENS3
a. Vaccine Ontology ID:
VO_0011501
b. Type:
DNA vaccine
c. Status:
Research
d. Antigen
Japanese encephalitis virus non-structural protein NS3
e. Gene Engineering of NS3
  • Type: DNA vaccine construction
  • Description: Amplified DNA fragments containing the NS3 gene was ligated to the pUBIQ vector at the EcoRI/XbaI site to construct pUJENS3 (Konishi et al., 2003).
  • Detailed Gene Information: Click here.
f. Vector:
pUBIQ vector
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: Four-to-six-week-old male BALB/c mice were immunized intramuscularly (i.m.) with 100 μg of plasmid DNA one to three times at intervals of 2 weeks. For evaluation of CTL induction, spleens were collected from groups of two immunized mice 2–4 weeks after the last immunization (Konishi et al., 2003).
  • Challenge Protocol: For evaluation of protective efficacy, groups of 6–12 immunized mice were bled retroorbitally for evaluating pre-challenge serum neutralizing antibody titers, and then challenged i.p. with 100 or 400 LD50 of the P3 strain of JE virus, 6 weeks after the first immunization. Mice were observed for 21 days, and surviving mice were bled for evaluating post-challenge serum neutralizing antibody titers. For monitoring virus load following challenge, groups of 18 immunized mice were challenged with 100 LD50 of the P3 strain, and 600–700 μl of blood and the whole brain were collected 1 h (day 0) or consecutive 5 days (days 1–5) following challenge from 3 mice per day per group (Konishi et al., 2003).
  • Efficacy: Researchers constructed plasmid DNAs encoding JE virus proteins. Cytotoxic T lymphocytes (CTLs) were induced by NS3 in a mouse model. Three immunizations with pUJENS3 provided a 50% partial protection from a lethal dose of JE virus (Konishi et al., 2003).
10. Japanese encephalitis virus DNA vaccine pUJENS5
a. Vaccine Ontology ID:
VO_0011352
b. Type:
DNA vaccine
c. Status:
Research
d. Antigen
Japanese encephalitis virus NS5
e. Gene Engineering of NS5
  • Type: DNA vaccine construction
  • Description: Amplified DNA fragments containing the NS5 gene was ligated to the pUBIQ8 vector at the BspEI and/or XbaI sites to construct pUJENS5 (Konishi et al., 2003).
  • Detailed Gene Information: Click here.
f. Vector:
pUBIQ vector
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: Four-to-six-week-old male BALB/c mice were immunized intramuscularly (i.m.) with 100 μg of plasmid DNA one to three times at intervals of 2 weeks. For evaluation of CTL induction, spleens were collected from groups of two immunized mice 2–4 weeks after the last immunization (Konishi et al., 2003).
  • Challenge Protocol: For evaluation of protective efficacy, groups of 6–12 immunized mice were bled retroorbitally for evaluating pre-challenge serum neutralizing antibody titers, and then challenged i.p. with 100 or 400 LD50 of the P3 strain of JE virus, 6 weeks after the first immunization. Mice were observed for 21 days, and surviving mice were bled for evaluating post-challenge serum neutralizing antibody titers. For monitoring virus load following challenge, groups of 18 immunized mice were challenged with 100 LD50 of the P3 strain, and 600–700 μl of blood and the whole brain were collected 1 h (day 0) or consecutive 5 days (days 1–5) following challenge from 3 mice per day per group (Konishi et al., 2003).
  • Efficacy: Researchers constructed plasmid DNAs encoding JE virus proteins. Cytotoxic T lymphocytes (CTLs) were induced by NS5 in a mouse model. Three immunizations with pUJENS5 provided a 57% partial protection from a lethal dose of JE virus (Konishi et al., 2003).
11. Japanese encephalitis virus vaccine BV-G-E
a. Vaccine Ontology ID:
VO_0011516
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Antigen
Japanese encephalitis virus envelope protein
e. Gene Engineering of Envelope protein
  • Type: Recombinant vector construction
  • Description: Recombinant pseudotype baculovirus (BV-G-E) was generated by inserting JEV E gene fragment into pFastBac-VSV/G vector. BALB/c mice were immunized with BV-G-E and challenged with JEV wild-type strain. The neutralization antibody, interferon (IFN)- expression and release, and survival rate were analysed and compared with the group of immunized with inactivated vaccine and DNA vaccine (pc-E) encoding the same gene of JEV (Li et al., 2009).
  • Detailed Gene Information: Click here.
f. Vector:
baculovirus pseudotyped with vesicular stomatitis virus glycoprotein (VSVG)
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: Four-week old female BALB/c mice (purchased from the Animal Centre, Institute of Medicine (Hubei Province, China) were randomly divided into seven groups (15 mice per group). Three groups were injected intramuscularly (i.m.) with 100 µl of PBS containing 1 × 108, 1 × 109 and 1 × 1010 PFU of BV-G-E, respectively. The other three groups were injected intramuscularly with 100 µl of PBS containing 1 × 1010 PFU of BV-G-EGFP or 100 µg of pc-E (a DNA vaccine construct expressing E protein) or 100 µl inactivated vaccine. The last group was used as a negative control by intramuscularly injecting 100 µl of PBS. Booster immunizations were identically performed 3 weeks later (Li et al., 2009).
  • Challenge Protocol: A subset of immunized mice was intraperitoneally (i.p.) challenged with 105 PFU of wild-type JEV P3 in 0.1 ml at 6 weeks following the initial immunization. Mouse mortality was monitored daily for 3 weeks (Li et al., 2009).
  • Efficacy: Researchers constructed a recombinant pseudotype baculovirus encoding the JEV envelope (E) protein and demonstrated that it could elicit high protective immunity in mice. Intramuscular injections of BV-G-E at various doses into mice produced higher levels of JEV-specific neutralizing antibodies, IFN-gamma and better protective efficacy against a lethal challenge with JEV than that of pc-E. Furthermore, BV-G-E could elicit a higher level of cellular immunity response and provide equal protective efficacy against JEV challenge compared to inactivated vaccine (Li et al., 2009).
  • Host Gene Response of Ifng (Interferon gamma)
    • Gene Response: An evident dose-dependent pattern of IFN-gamma production could be observed in mice immunized with BV-G-E. As expected, no significant production of IFN-γ was detected in PBS-inoculated mice. Interestingly, the mean relative IFN-γ mRNA expression in the group of BV-G-EGFP was also significantly higher than that of pc-E vaccinated mice in splenocytes (Li et al., 2009).
    • Detailed Gene Information: Click here.
12. JE-Vax
a. Product Name:
Japanese Encephalitis Virus Vaccine Inactivated
b. Tradename:
JE-Vax
c. Manufacturer:
Research Foundation for Microbial Diseases of Osaka University, License #1156
d. Vaccine Ontology ID:
VO_0000066
e. CDC CVX code:
39
f. Type:
Inactivated or "killed" vaccine
g. Status:
Licensed
h. Location Licensed:
USA
i. Host Species for Licensed Use:
Human
j. Antigen
Inactivated Japanese encephalitis (JE) virus “Nakayama-NIH” strain
k. Preparation
JE-VAX is prepared by inoculating mice intracerebrally with Japanese encephalitis (JE) virus, “Nakayama-NIH” strain. Infected brains are harvested and homogenized in PBS, pH 8.0. The homogenate is centrifuged and the supernatant inactivated with formaldehyde, then processed to yield a partially purified, inactivated virus suspension. This is further purified by ultra-centrifugation through 40% w/v sucrose. The suspension is then lyophilized. Thimerosal (mercury derivative) is added as a preservative to a final concentration of 0.007%. The diluent sterile water for Injection contains no preservative. Each 1.0 mL dose contains approximately 500 μg of gelatin, less than 100 μg of formaldehyde, less than 0.0007% v/v Polysorbate 80, and less than 50 ng of mouse serum protein. No myelin basic protein can be detected at the detection threshold of the assay (<2 ng/mL). Prior to reconstitution, the vaccine is a white caked powder. After reconstitution, the vaccine is a colorless transparent liquid (FDA: JE-Vax).
l. Immunization Route
subcutaneous injection
m. Storage
The vaccine should be stored at 2° to 8°C (35° to 46°F). DO NOT FREEZE. After reconstitution the vaccine should be stored at 2° to 8°C (35° to 46°F) and used within 8 hours. DO NOT FREEZE RECONSTITUTED VACCINE.
n . Approved Age for Licensed Use
Age 1 year and older
o. Contraindication
Adverse reactions to a prior dose of JE vaccine manifesting as generalized urticaria and angioedema and should not be administered to persons with a proven or suspected hypersensitivity to proteins of rodent or neural origin. (FDA: JE-Vax).
p. Description
JE-VAX is a sterile, lyophilized vaccine for subcutaneous use Ref747:FDA: Jevax].
q. Human Response
  • Vaccination Protocol: In a placebo-controlled, randomized clinical trial in Thai children, sponsored by the US Army. In this trial, children between 1 and 14 years of age received BIKEN monovalent Nakayama-NIH strain (n = 21,628) or a bivalent vaccine containing the Nakayama-NIH and Beijing JE virus strains (n = 22,080) or tetanus toxoid as a placebo (n = 21,516) (FDA: JE-Vax).
  • Side Effects: Side effects that were reported included: headache, sore arm, rash, and swelling
  • Efficacy: One case (5 cases/100,000) of Japanese encephalitis (JE) occurred in the monovalent vaccine group, one case (5 cases/100,000) in the bivalent vaccine group, and 11 cases (51 cases/100,000) in the placebo group. The observed efficacy of both monovalent and bivalent vaccines was 91% (FDA: JE-Vax).
  • Description: JE-VAX should be considered for use in persons who plan to reside in or travel to areas where JE is endemic or epidemic during a transmission season
13. NYVAC-JEV
a. Vaccine Ontology ID:
VO_0004776
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Preparation
Poxvirus-vectored vaccines for Japanese encephalitis (JE), NYVAC-JEV and ALVAC-JEV(Raengsakulrach et al., 1999).
f. Immunization Route
Intramuscular injection (i.m.)
g. Monkey Response
  • Vaccination Protocol: The vaccines were given to four monkeys each on study days 0 and 28 along with saline placebo on day 7. For controls, the licensed BIKEN JE vaccine and a saline placebo were given to other groups of four monkeys on days 0, 7, and 28 (Raengsakulrach et al., 1999).
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: Two months after the booster dose, all 16 monkeys were challenged intranasally with one 90% effective dose of JEV strain KE-93 (AP61-1, C6/36-1, Mm-1, SM-2) (Raengsakulrach et al., 1999).
  • Efficacy: This study suggests that the NYVAC-JEV and ALVAC-JEV vaccines are safe and immunogenic in monkeys and that the NYVAC-JEV and BIKEN vaccines are effective in protecting monkeys from encephalitis (Raengsakulrach et al., 1999).
14. NYVAC-JEV- prM/E/ NS1
a. Vaccine Ontology ID:
VO_0004780
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Gene Engineering of PrM
  • Type: Recombinant vector construction
  • Description: A highly attenuated strain of vaccinia virus (NYVAC) was engineered to express the Japanese encephalitis virus (JEV) prM, E, and NS1 genes or the prM and E genes (Konishi et al., 1992).
  • Detailed Gene Information: Click here.
f. Gene Engineering of NS1
  • Type: Recombinant vector construction
  • Description: A highly attenuated strain of vaccinia virus (NYVAC) was engineered to express the Japanese encephalitis virus (JEV) prM, E, and NS1 genes or the prM and E genes (Konishi et al., 1992).
  • Detailed Gene Information: Click here.
g. Gene Engineering of Envelope protein
  • Type: Recombinant protein preparation
  • Description: A highly attenuated strain of vaccinia virus (NYVAC) was engineered to express the Japanese encephalitis virus (JEV) prM, E, and NS1 genes or the prM and E genes (Konishi et al., 1992).
  • Detailed Gene Information: Click here.
h. Preparation
Highly attenuated strain of vaccinia virus (NYVAC) was engineered to express the Japanese encephalitis virus (JEV) prM, E, and NS1 genes or the prM and E genes (Konishi et al., 1992).
i. Immunization Route
Intramuscular injection (i.m.)
j. Pig Response
  • Vaccination Protocol: The recombinant viruses were tested as vaccine candidates in pigs, a natural host of JEV. JEV-neutralizing and hemagglutination-inhibiting antibodies appeared in swine sera 7 days after immunization with 108 PFU of the recombinant viruses and increased after a second dose at 28 days (Konishi et al., 1992).
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: JEV challenge (d56) of the swine with 2 × 108 PFU of JEV (Konishi et al., 1992).
  • Efficacy: The JEV levels detected in the serum after JEV challenge were significantly reduced in animals inoculated with the recombinant viruses (Konishi et al., 1992).
V. References
1. FDA: Ixiaro: FDA: Ixiaro [http://www.fda.gov/BiologicsBloodVaccines/Vaccines/ApprovedProducts/ucm179132.htm]
2. FDA: JE-Vax: FDA: JE-Vax vaccine information [http://www.fda.gov/BiologicsBloodVaccines/Vaccines/ApprovedProducts/ucm094048.htm]
3. Konishi et al., 1992: Konishi E, Pincus S, Paoletti E, Laegreid WW, Shope RE, Mason PW. A highly attenuated host range-restricted vaccinia virus strain, NYVAC, encoding the prM, E, and NS1 genes of Japanese encephalitis virus prevents JEV viremia in swine. Virology. 1992; 190(1); 454-458. [PubMed: 1326813].
4. Konishi et al., 2003: Konishi E, Ajiro N, Nukuzuma C, Mason PW, Kurane I. Comparison of protective efficacies of plasmid DNAs encoding Japanese encephalitis virus proteins that induce neutralizing antibody or cytotoxic T lymphocytes in mice. Vaccine. 2003; 21(25-26); 3675-3683. [PubMed: 12922097].
5. Kulkarni et al., 2012: Kulkarni R, Sapkal G, Gore M. Evaluation of Japanese encephalitis virus polytope DNA vaccine candidate in BALB/c mice. Virus research. 2012; 170(1-2); 118-125. [PubMed: 23007095].
6. Li et al., 2009: Li Y, Ye J, Cao S, Xiao S, Zhao Q, Liu X, Jin M, Chen H. Immunization with pseudotype baculovirus expressing envelope protein of Japanese encephalitis virus elicits protective immunity in mice. The journal of gene medicine. 2009; 11(1); 57-65. [PubMed: 19006097].
7. Raengsakulrach et al., 1999: Raengsakulrach B, Nisalak A, Gettayacamin M, Thirawuth V, Young GD, Myint KS, Ferguson LM, Hoke CH Jr, Innis BL, Vaughn DW. Safety, immunogenicity, and protective efficacy of NYVAC-JEV and ALVAC-JEV recombinant Japanese encephalitis vaccines in rhesus monkeys. The American journal of tropical medicine and hygiene. 1999; 60(3); 343-349. [PubMed: 10466959].
8. Sheets et al., 2006: Sheets RL, Stein J, Manetz TS, Duffy C, Nason M, Andrews C, Kong WP, Nabel GJ, Gomez PL. Biodistribution of DNA plasmid vaccines against HIV-1, Ebola, Severe Acute Respiratory Syndrome, or West Nile virus is similar, without integration, despite differing plasmid backbones or gene inserts. Toxicological sciences : an official journal of the Society of Toxicology. 2006; 91(2); 610-619. [PubMed: 16569729].
9. Wiki: Japanese encephalitis: Wiki: Japanese encephalitis [http://en.wikipedia.org/wiki/Japanese_encephalitis]
10. Wu et al., 2006: Wu CJ, Li TL, Huang HW, Tao MH, Chan YL. Development of an effective Japanese encephalitis virus-specific DNA vaccine. Microbes and infection / Institut Pasteur. 2006; 8(11); 2578-2586. [PubMed: 16949850].
11. Xu et al., 2004: Xu G, Xu X, Li Z, He Q, Wu B, Sun S, Chen H. Construction of recombinant pseudorabies virus expressing NS1 protein of Japanese encephalitis (SA14-14-2) virus and its safety and immunogenicity. Vaccine. 2004; 22(15-16); 1846-1853. [PubMed: 15121294].
12. Yasuda et al., 1990: Yasuda A, Kimura-Kuroda J, Ogimoto M, Miyamoto M, Sata T, Sato T, Takamura C, Kurata T, Kojima A, Yasui K. Induction of protective immunity in animals vaccinated with recombinant vaccinia viruses that express PreM and E glycoproteins of Japanese encephalitis virus. Journal of virology. 1990; 64(6); 2788-2795. [PubMed: 2159544].
13. Zhao et al., 2003: Zhao Z, Wakita T, Yasui K. Inoculation of plasmids encoding Japanese encephalitis virus PrM-E proteins with colloidal gold elicits a protective immune response in BALB/c mice. Journal of virology. 2003; 77(7); 4248-4260. [PubMed: 12634382].