Bordetella pertussis 520 Whooping Cough Bordetella pertussis is a Gram-negative, aerobic coccobacillus of the genus Bordetella, and the causative agent of pertussis or whooping cough. Pertussis (or Whooping Cough), is an infection of the respiratory system and characterized by a “whooping” sound when the person breathes in. In the US it killed 5,000 to 10,000 people per year before a vaccine was available. Vaccination has transformed this and between 1985-88 fewer than 100 children died from pertussis. Worldwide in 2000, according to the WHO, around 39 million people were infected annually and about 297,000 died. A graph is available showing the dramatic effect of introducing vaccination in England. Bordetella pertussis infects its host by colonizing lung epithelial cells. The bacterium contains a surface protein, filamentous hemagglutinin, which binds to sulfatides that are found on cilia of epithelial cells. Once anchored, the bacterium produces tracheal cytotoxin, which stops the cilia from beating. This prevents the cilia from clearing debris from the lungs, so the body responds by sending the host into a coughing fit. These coughs expel some bacteria into the air, which are free to infect other hosts. Bordetella pertussis has the ability to inhibit the function of the host's immune system. Two toxins, known as the pertussis toxin (or PTx) and adenylate cyclase (CyaA), are responsible for this inhibition. CyaA converts ATP to cyclic AMP, and PTx inhibits an intracellular protein that regulates this process. The end result is that phagocytes convert too much ATP to cyclic AMP, which can cause disturbances in cellular signaling mechanisms, and prevent phagocytes from correctly responding to an infection. The infection occurs most with children under the age of one when they are unimmunized or children with faded immunity, normally around the age 11 through 18. The signs and symptoms are similar to a common cold: runny nose, sneezing, mild cough, and low-grade fever. The patient becomes most contagious during the catarrhal stage of infection, normally 2 weeks after the coughing begins. It may become airborne when the person coughs, sneezes, or laughs. Pertussis vaccine is part of the DTaP (diphtheria, tetanus, acellular pertussis) immunization. The paroxysmal cough precedes a crowing inspiratory sound characteristic of pertussis. After a spell, the patient might make a “whooping” sound when breathing in, or vomit. Adults have milder symptoms, like prolonged coughing without the “whoop.” Infants less than 6 months may not have the typical whoop. A coughing spell may last a minute or more, producing cyanosis, apnoea and seizures. However, when not in a coughing fit, the patient does not experience trouble breathing. This is because Bordetella pertussis inhibits the immune response and therefore very little mucus is generated in the lungs. A prolonged cough may be irritating and sometimes a disabling cough may go undiagnosed in adults for many months. Bordetella pertussis also produces a lymphocytosis-promoting factor, which causes a decrease in the entry of lymphocytes into lymph nodes. This can lead to a condition known as lymphocytosis, with a complete lymphocyte count over of 4000/μL in adults or over 8000/μL in children (Wiki: Bordetella pertussis). Cattle Bos taurus 9913 Chicken Gallus gallus 9031 chinchillas Chinchillidae 10150 Copper Pheasant Syrmaticus soemmerringii 9067 Deer mouse Peromyscus maniculatus 10042 Ducks Anas 8835 Ferret Mustela putorius furo 9669 Goat Capra hircus 9925 Guinea pig Cavia porcellus 10141 Hamster Mesocricetus auratus 10036 Horse Equus caballus 9796 Human Homo sapiens 9606 Monkey Platyrrhini 9479 Mouse Mus musculus 10090 Pig Sus scrofa 9823 Rabbit Oryctolagus cuniculus 9986 Rat Rattus 10114 Raven Corvus corax 56781 Sheep Ovis aries 9940 Vole Microtus ochrogaster 79684 Actacel Actacel Sanofi Pasteur Ltd VO_0010705 Licensed Intramuscular injection (i.m.) Canada Alum Intramuscular injection (i.m.) Adacel Tetanus Toxoid, Reduced Diphtheria Toxoid and Acellular Pertussis Vaccine, Adsorbed Adacel Sanofi Pasteur, Ltd (USA: License #1726) VO_0000005 Licensed Intramuscular injection (i.m.) USA: License #1726 aluminum phosphate Adacel vaccine should be stored at 2° to 8°C (35° to 46°F). DO NOT FREEZE Intramuscular injection (i.m.) B. pertussis BrkA protein vaccine VO_0011377 Research Subcutaneous injection Subcutaneous injection Recombinant protein preparation Fraction BS was applied to a Mono Q Sepharose (Amersham, Biosciences) (0.5 mg protein per ml resin) previously equilibrated with 25 mM Tris–HCl, pH 8.0. Proteins were eluted with a NaCl gradient (0–1 M) in 25 mM Tris–HCl, pH 8.0, in 0.5 ml fractions at a flow rate of 1 ml/min. Elution was monitored at A280 nm. The fractions showing the same peak profile were pooled and eluted again under the same chromatography conditions. Samples were submitted to sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) (T = 12.5% in 0.75 M Tris, 0.2% SDS, pH 8.8) and electrophoresis was performed at 60 mA in 25 mM Tris, 0.192 M glycine, 0.1% SDS, pH 8.3. The gel was stained with silver nitrate and fractions showing a similar molecular mass profile were pooled, concentrated by centrifugation at 440 × g in Centrifugal Ultrafree-20 tubes, 10 kDa (Millipore), and their protein concentration was evaluated. Four pools were formed (P1, P2, P3, P4), and used for immunization of mice (Cainelli et al., 2007). BALB/c Female BALB/c mice, 4–6 weeks old (Animal House of the Instituto Butantan) (9–15 mice/group) were subcutaneously injected three times at weekly intervals (days 0, 7, 14) with BS pools (P1, P2, P3, P4) (1 μg/0.1 ml/mouse), and two times (days 0 and 14) with 73 kDa or 60 kDa proteins (1 μg/0.1 ml/mouse) alone or mixed with Diphtheria-Pertussis-Tetanus (DPT) vaccine formulated without aluminum hydroxide (NA-DPT), (2 μl/mouse), (Instituto Butantan). Current DPT vaccine containing aluminum hydroxide (DPTBut) was used as control (2 μl/mouse) (Lot no. 0008147/0 and 0309132, Instituto Butantan). Non-immunized mice (injected with physiologic saline) were used as control (Cainelli et al., 2007). High levels of antibodies were induced, and a 78% protection rate of mice challenged with live B. pertussis was observed. The 73 kDa N-terminal alpha-domain of BrkA autotransporter protein, one protein identified in the fraction, stimulated antibodies against pertussis and induced a 42% protection rate against the challenge (Cainelli et al., 2007). Animals were challenged by intracerebral route (i.c.) with live B. pertussis (strain 18323, NIH, USA), 21 days after the first immunization. Each mouse was inoculated with 30,000 live bacteria. Deaths were recorded until day 15 (Cainelli et al., 2007). B. pertussis Cpn60 protein vaccine VO_0011357 Research Subcutaneous injection Subcutaneous injection Recombinant protein preparation Fraction BS was applied to a Mono Q Sepharose (Amersham, Biosciences) (0.5 mg protein per ml resin) previously equilibrated with 25 mM Tris–HCl, pH 8.0. Proteins were eluted with a NaCl gradient (0–1 M) in 25 mM Tris–HCl, pH 8.0, in 0.5 ml fractions at a flow rate of 1 ml/min. Elution was monitored at A280 nm. The fractions showing the same peak profile were pooled and eluted again under the same chromatography conditions. Samples were submitted to sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) (T = 12.5% in 0.75 M Tris, 0.2% SDS, pH 8.8) and electrophoresis was performed at 60 mA in 25 mM Tris, 0.192 M glycine, 0.1% SDS, pH 8.3. The gel was stained with silver nitrate and fractions showing a similar molecular mass profile were pooled, concentrated by centrifugation at 440 × g in Centrifugal Ultrafree-20 tubes, 10 kDa (Millipore), and their protein concentration was evaluated. Four pools were formed (P1, P2, P3, P4), and used for immunization of mice (Cainelli et al., 2007). BALB/c Female BALB/c mice, 4–6 weeks old (Animal House of the Instituto Butantan) (9–15 mice/group) were subcutaneously injected three times at weekly intervals (days 0, 7, 14) with BS pools (P1, P2, P3, P4) (1 μg/0.1 ml/mouse), and two times (days 0 and 14) with 73 kDa or 60 kDa proteins (1 μg/0.1 ml/mouse) alone or mixed with Diphtheria-Pertussis-Tetanus (DPT) vaccine formulated without aluminum hydroxide (NA-DPT), (2 μl/mouse), (Instituto Butantan). Current DPT vaccine containing aluminum hydroxide (DPTBut) was used as control (2 μl/mouse) (Lot no. 0008147/0 and 0309132, Instituto Butantan). Non-immunized mice (injected with physiologic saline) were used as control (Cainelli et al., 2007). High levels of antibodies were induced, and a 78% protection rate of mice challenged with live B. pertussis was observed. The Cpn60/60 kDa chaperonin, one protein identified in the fraction, stimulated antibodies against pertussis and induced a 42% protection rate against the challenge (Cainelli et al., 2007). Animals were challenged by intracerebral route (i.c.) with live B. pertussis (strain 18323, NIH, USA), 21 days after the first immunization. Each mouse was inoculated with 30,000 live bacteria. Deaths were recorded until day 15 (Cainelli et al., 2007). B. pertussis CyaA protein vaccine VO_0011359 Research Subcutaneous injection Subcutaneous injection Recombinant protein preparation The AC was purified from culture supernatants using a camodulin affinity chromatography. The preparation consisted of two polypeptides of 45 and 43 kDa that are structurally related as described by Ladant et al (Guiso et al., 1989). BALB/c For active immunizations, Balb/c mice were given, subcutaneously, 3,ug of purified AC adsorbed on aluminium hydroxide, three times, at one week intervals . The mice were bled 5 days after the last injection in order to assess the presence of circulating anti-AC antibodies . The lethal challenge was performed 9 days after the final injection (Guiso et al., 1989). Active immunization with purified B. pertussis secreted adenylate cyclase (cyaA) protect mice against a lethal respiratory challenge with B. pertussis or B. parapertussis (Guiso et al., 1989). Bacterial suspension (50 pl) was injected intranasally to groups of 10 3-week-old female Balb/c mice (CERJ, St Berthevin, France), weighing 16±1 g . The LD 50 for the challenge inocula was determined daily by recording the number of dead mice . Pulmonary edema was quantified by lung weight (Guiso et al., 1989). B. pertussis DNA vaccine encoding Prn VO_0011391 Research Subcutaneous injection Subcutaneous injection DNA vaccine construction To construct a prn mutant, amplification of the region containing the whole prn2 gene of the CCHMC1 strain was performed using PRN-F GGCACAGGACCGGCGCGTGTTTCGCGCACGACTCT) and PRN-R (CGCGTGGTGCGCCTGAAAGGCGGCGATGCCTTCA) with attB adaptors. The PCR products were cloned into pDONR221 to obtain pDONR-PTXA1 and pDONR-PRN2 by site-specific recombination techniques using the Gateway cloning system (Invitrogen). The regions transferred into the pDONR221 plasmid were sequenced for verification. pDONR-PTXA1 or pDONR-PRN2 was mixed with pABB-CRS2 to obtain pABB-PTXA1 and pABB-PRN2 by using the Gateway cloning system. pABB-PTXA1 or pABB-PRN2 was introduced into E. coli SM10pir and mobilized into the B. pertussis strain Tohama by conjugation (Komatsu et al., 2010). BALB/c 3.5-week-old female BALB/c mice (Japan SLC, Hamamatsu) were immunized by two subcutaneous injections of 0.25 SHDs (0.125 ml) over a 2-week interval (Komatsu et al., 2010). While the vaccine was effective against all of the B. pertussis strains regardless of the allele expression pattern, the strain expressing ptxA1 and prn2 displayed a survival advantage over the other strains (Komatsu et al., 2010). Two weeks after the second immunization, 50 µl of a suspension containing approximately 6 x 10^6 CFU of B. pertussis was instilled intranasally into mice anesthetized by intraperitoneal injection with pentobarbital sodium (Nembutal; Abbott Laboratories, Abbott Park, IL). Two hours (day 0) or 2, 5, or 8 days after the challenge, the mice were euthanized by pentobarbital injection (Komatsu et al., 2010). B. pertussis DNA vaccine encoding TcfA VO_0011413 Research Intranasal Intranasal DNA vaccine construction tcfA was amplified from the B. pertussis BP18323 Smr chromosome by using Taq DNA polymerase (Boehringer Mannheim). The forward primer was oligonucleotide Tcf1 (5′-ACTAGTGATCATATGCACAATTTACGGAAATA-3′), which contains the initial codon of tcfA, comprised within the NdeI site, and an upstream BclI site; the reverse primer was oligonucleotide Tcf2 (5′-GTCTAGAATTCTACCAGGCGTAGCGATACC-3′), containing the stop codon of the tcfA gene and an EcoRI site downstream. The amplification product was digested with BclI and EcoRI and cloned into pBlueScript/KS+ (Stratagene) between EcoRI and BamHI sites, giving origin to pBS-tcf (Chen et al., 1998). BALB/c Female BALB/c mice (6 to 8 weeks old; Charles River, Calco, Italy) each received 30 μl of a bacterial suspension in PBS by the intranasal route, either without anesthesia or anesthetized with 0.2 ml of a mixture of 15% xylazine hydrochloride (Rompun) and 10% ketamine hydrochloride (Ketavet), on days 0, 28, 42, and 56 (Chen et al., 1998). Intranasal administration of IEM101 expressing Tcf induced a significant reduction in bacterial colonization of the tracheas of mice challenged with wild-type B. pertussis. These data are in agreement with the putative role of Tcf in Bordetella tracheal colonization (Chen et al., 1998). B. pertussis 18323 Smr was grown for 2 days on a BG plate and then inoculated into 100 ml of SS modified medium; the culture was grown until it reached an OD590 of 0.5. Bacteria were then diluted in PBS to a concentration of 3.3 × 10^8 CFU/ml; the concentration was confirmed by serial dilution and plating. Animals received 30 μl of the bacterial suspension (corresponding to approximately 10^6 CFU) intranasally, under light anesthesia. Colonization of the trachea and lungs was monitored by counting CFU recovered from organ homogenates (Bruss and Siber, 2002). B. pertussis FhaB and 69 kDa OMP protein vaccine VO_0011498 Research Intramuscular injection (i.m.) Intramuscular injection (i.m.) Recombinant protein preparation A crystal clear supernatant of 5-day-old static cultures containing proteolysis inhibitor was purified. To remove impurities, the FHA was precipitated by overnight dialysis against 25-30 volumes of buffer A at 4 C, and the precipitate was collected by centrifugation. The precipitated FHA was dissolved in the smallest possible volume of 40 mM B-alanine buffer at pH 3.5, clarified by centrifugation, and applied at room temperature at a flow of 30 ml/h to a Superose 12 column. The retained highly purified FHA was eluted (Novotny et al., 1991). Groups of mice were injected intraperitoneally with 0.5 ml volumes of four concentrations (Novotny et al., 1991). A combination of the 69-kDa outer membrane protein and filamentous hemagglutinin (fhaB), both isolated from lymphocytosis promoting factor (LPF; pertussis toxin) minus mutants of Bordetella pertussis, is protective in the mouse intracerebral challenge potency (Kendrick) test (Novotny et al., 1991). Mice were challenged intracerebrally 14 days after antigen injection. The challenge dose contained 300-400 LD50, and a 1:1250 dilution of the challenge does contained ~ 10cfu. All mice were challenged within 90 minutes after the challenge suspension was thawed; the challenge was injected using a 1 ml syringe in a Hamilton PB600-I dispensor that reproducibly delivers 20-ul voumes (Novotny et al., 1991). B. pertussis PTx protein vaccine VO_0011361 Research Intraperitoneal injection (i.p.) Aluminum hydroxide Intraperitoneal injection (i.p.) Recombinant protein preparation Vaccine is prepared by chemically modifying purified PT from culture supernatants with tetranitromethane (TNM). The lot was adsorbed to aluminum hydroxide (Alhydogel; Superfos, Vedbaek, Denmark) at a concentration of 50 μg of protein adsorbed to 4 mg per 1.0 ml. Animal doses (2.5, 0.5, and 0.1 μg) were prepared by making fivefold serial dilutions in aluminum hydroxide (4 mg/ml) diluent and given in a volume of 50 μl (Bruss and Siber, 2002). Recombinant protein preparation Vaccine is prepared by chemically modifying purified PT from culture supernatants with tetranitromethane (TNM). The lot was adsorbed to aluminum hydroxide (Alhydogel; Superfos, Vedbaek, Denmark) at a concentration of 50 μg of protein adsorbed to 4 mg per 1.0 ml. Animal doses (2.5, 0.5, and 0.1 μg) were prepared by making fivefold serial dilutions in aluminum hydroxide (4 mg/ml) diluent and given in a volume of 50 μl (Bruss and Siber, 2002). Recombinant protein preparation Vaccine is prepared by chemically modifying purified PT from culture supernatants with tetranitromethane (TNM). The lot was adsorbed to aluminum hydroxide (Alhydogel; Superfos, Vedbaek, Denmark) at a concentration of 50 μg of protein adsorbed to 4 mg per 1.0 ml. Animal doses (2.5, 0.5, and 0.1 μg) were prepared by making fivefold serial dilutions in aluminum hydroxide (4 mg/ml) diluent and given in a volume of 50 μl (Bruss and Siber, 2002). Recombinant protein preparation Vaccine is prepared by chemically modifying purified PT from culture supernatants with tetranitromethane (TNM). The lot was adsorbed to aluminum hydroxide (Alhydogel; Superfos, Vedbaek, Denmark) at a concentration of 50 μg of protein adsorbed to 4 mg per 1.0 ml. Animal doses (2.5, 0.5, and 0.1 μg) were prepared by making fivefold serial dilutions in aluminum hydroxide (4 mg/ml) diluent and given in a volume of 50 μl (Bruss and Siber, 2002). Recombinant protein preparation Vaccine is prepared by chemically modifying purified PT from culture supernatants with tetranitromethane (TNM). The lot was adsorbed to aluminum hydroxide (Alhydogel; Superfos, Vedbaek, Denmark) at a concentration of 50 μg of protein adsorbed to 4 mg per 1.0 ml. Animal doses (2.5, 0.5, and 0.1 μg) were prepared by making fivefold serial dilutions in aluminum hydroxide (4 mg/ml) diluent and given in a volume of 50 μl (Bruss and Siber, 2002). BALB/c Mice were removed from their cages, weighed, and placed on a stainless steel rack that fits inside of the Plexiglas aerosol chamber (40 by 40 by 40 cm). The 21-h culture of B. pertussis was suspended in sterile PBS to a concentration of approximately 2 × 10^9 CFU/ml of inoculum. This inoculum was delivered to the mice using a standard nebulizer (model 647; Devilbis, Somerset, Pa.) with a set pressure of 1.5 kg/cm2. The chamber and the nebulizer were enclosed in a biosafety level-2 hood and certified prior to use to document that airflow barriers were maintained. Uniformity of aerosol in the chamber was maintained with the use of two PABST 900 series AC fans (Newark Supply, Newark, N.J.). The even dispersion of the aerosol was confirmed with a light laser (Bruss and Siber, 2002). BALB/c mice were immunized with PTx vaccine on day 6 of life and then challenged with B. pertussis using the aerosol challenge model. These primed mice were significantly better protected against leukocytosis, weight loss, and proliferation of B. pertussis in the lungs following aerosol challenge than the nonprimed group. This protection correlated with levels of anti-PT antibody in serum present on the day of aerosol challenge (Bruss and Siber, 2002). Mice were exposed to nebulization for 30 min and removed 30 min after termination of aerosol. The completion of the aerosol represented time 0. Mice were removed from the box and replaced into their cages. Cages were checked daily for mortality (Bruss and Siber, 2002). Boostrix Tetanus Toxoid, Reduced Diphtheria Toxoid and Acellular Pertussis Vaccine, Adsorbed Boostrix GlaxoSmithKline Biologicals VO_0000015 Licensed Intramuscular injection (i.m.) USA (License #1617) Aluminum Phosphate Store refrigerated between 2º and 8ºC (36º and 46ºF). Do not freeze. Intramuscular injection (i.m.) DAPTACEL Diphtheria and Tetanus Toxoids and Acellular Pertussis Vaccine Adsorbed DAPTACEL Sanofi Pasteur, Ltd. VO_0000029 Licensed Intramuscular injection (i.m.) USA (License #1726) aluminum phosphate Should be stored at 2° to 8°C (35° to 46°F). DO NOT FREEZE. Intramuscular injection (i.m.) Infanrix Diphtheria and Tetanus Toxoids and Acellular Pertussis Vaccine Adsorbed Infanrix GlaxoSmithKline Biologicals VO_0000064 Licensed Intramuscular injection (i.m.) USA (License #1617 ) Aluminum Hydroxide Store INFANRIX refrigerated between 2° and 8°C (36° and 46°F). Do not freeze. Intramuscular injection (i.m.) Infanrix -IPV/Hib Infanrix -IPV/Hib GlaxoSmithKline VO_0010722 Licensed Intramuscular injection (i.m.) Canada Alum Intramuscular injection (i.m.) Infanrix-hexa Combined diphtheria and tetanus toxoids, acellular pertussis, hepatitis B (recombinant), inactivated poliomyelitis and adsorbed conjugated Haemophilus influenzae type b vaccine Infanrix-hexa GlaxoSmithKline VO_0010719 Licensed Intramuscular injection (i.m.) Canada Alum Should be stored at 2° to 8°C (35° to 46°F). Intramuscular injection (i.m.) Infanrix-IPV Infanrix-IPV GlaxoSmithKline VO_0010721 Licensed Intramuscular injection (i.m.) Canada Alum Intramuscular injection (i.m.) Infantrix/Hib Infanrix/Hib GlaxoSmithKline VO_0010720 Licensed Intramuscular injection (i.m.) Canada Alum Intramuscular injection (i.m.) Pediacel Diphtheria and Tetanus Toxoids and Acellular Pertussis Vaccine Adsorbed Combined with Inactivated Poliomyelitis Vaccine and Haemophilus b Conjugate Vaccine (Tetanus Protein – Conjugate) Pediacel Sanofi Pasteur Ltd VO_0010730 Licensed Intramuscular injection (i.m.) Canada Alum Store at 2° to 8°C (35° to 46°F). Intramuscular injection (i.m.) Pediarix Diphtheria and Tetanus Toxoids and Acellular Pertussis Adsorbed, Hepatitis B (Recombinant) and Inactivated Poliovirus Vaccine Combined Pediarix GlaxoSmithKline Biologicals VO_0000082 Licensed Intramuscular injection (i.m.) United States Aluminum hydroxide The vaccine should be refrigerated between 2º and 8ºC (36º and 46ºF). Do not freeze. Intramuscular injection (i.m.) Pentacel Diphtheria and Tetanus Toxoids and Acellular Pertussis Adsorbed, Inactivated Poliovirus and Haemophilus b Conjugate (Tetanus Toxoid Conjugate) Vaccine Pentacel Sanofi Pasteur Limited VO_0000084 Licensed Intramuscular injection (i.m.) USA (License #1726), Canada Aluminum phosphate Store at 2° to 8°C (35° to 46°F). Do not freeze. Intramuscular injection (i.m.) Quadracel Diphtheria and Tetanus Toxoids and Acellular Pertussis Vaccine Adsorbed Combined with Inactivated Poliomyelitis Vaccine Quadracel Sanofi Pasteur Ltd VO_0010736 Licensed Intramuscular injection (i.m.) Canada Aluminum phosphate Store at 2 to 8C (35 to 46F). Do not freeze. Intramuscular injection (i.m.) Tripacel Pertussis Vaccine-Acellular, Combined with Diphtheria and Tetanus Toxoids (Adsorbed) Tripacel Sanofi Pasteur Ltd VO_0010742 Licensed Intramuscular injection (i.m.) Canada Aluminum phospate Store at at 2° to 8°C. Intramuscular injection (i.m.) Tripedia Diphtheria and Tetanus Toxoids and Acellular Pertussis Vaccine Adsorbed Tripedia Sanofi Pasteur, Inc. VO_0000112 Licensed Intramuscular injection (i.m.) USA (FDA License #1725) aluminum potassium sulfate Store between 2 and 8 degrees Celsius. DO NOT FREEZE. Intramuscular injection (i.m.) BrkA Bordetella pertussis VO_0011036 562026 CDD:29328 CDD:162346 CDD:154874 520 ? BrkA 7.12 95737.8 1010 Pertactin-like passenger domains (virulence factors), C-terminal, subgroup 1, of autotransporter proteins of the type V secretion system of Gram-negative bacteria. This subgroup includes the passenger domains of Neisseria and Haemophilus IgA1 proteases...; cd01343 >gi|562026|gb|AAA51646.1| BrkA [Bordetella pertussis] MYLDRFRQCPSSLQIPRSAWRLHALAAALALAGMARLAPAAAQAPQPPVAGAPHAQDAGQEGEFDHRDNT LIAVFDDGVGINLDDDPDELGETAPPTLKDIHISVEHKNPMSKPAIGVRVSGAGRALTLAGSTIDATEGG IPAVVRRGGTLELDGVTVAGGEGMEPMTVSDAGSRLSVRGGVLGGEAPGVGLVRAAQGGQASIIDATLQS ILGPALIADGGSISVAGGSIDMDMGPGFPPPPPPLPGAPLAAHPPLDRVAAVHAGQDGKVTLREVALRAH GPQATGVYAYMPGSEITLQGGTVSVQGDDGAGVVAGAGLLDALPPGGTVRLDGTTVSTDGANTDAVLVRG DAARAEVVNTVLRTAKSLAAGVSAQHGGRVTLRQTRIETAGAGAEGISVLGFEPQSGSGPASVDMQGGSI TTTGNRAAGIALTHGSARLEGVAVRAEGSGSSAAQLANGTLVVSAGSLASAQSGAISVTDTPLKLMPGAL ASSTVSVRLTDGATAQGGNGVFLQQHSTIPVAVALESGALARGDIVADGNKPLDAGISLSVASGAAWHGA TQVLQSATLGKGGTWVVNADSRVQDMSMRGGRVEFQAPAPEASYKTLTLQTLDGNGVFVLNTNVAAGQND QLRVTGRADGQHRVLVRNAGGEADSRGARLGLVHTQGQGNATFRLANVGKAVDLGTWRYSLAEDPKTHVW SLQRAGQALSGAANAAVNAADLSSIALAESNALDKRLGELRLRADAGGPWARTFSERQQISNRHARAYDQ TVSGLEIGLDRGWSASGGRWYAGGLLGYTYADRTYPGDGGGKVKGLHVGGYAAYVGDGGYYLDTVLRLGR YDQQYNIAGTDGGRVTADYRTSGAAWSLEGGRRFELPNDWFAEPQAEVMLWRTSGKRYRASNGLRVKVDA NTATLGRLGLRFGRRIALAGGNIVQPYARLGWTQEFKSTGDVRTNGIGHAGAGRHGRVELGAGVDAALGK GHNLYASYEYAAGDRINIPWSFHAGYRYSF Protective antigen A soluble fraction obtained from Bordetella pertussis was evaluated as adjuvant for the pertussis component of the Diphtheria-Pertussis-Tetanus (DPT) vaccine. High levels of antibodies were induced, and a 78% protection rate of mice challenged with live B. pertussis was observed. Two proteins were identified as the 73 kDa N-terminal alpha-domain of BrkA autotransporter protein and the Cpn60/60 kDa chaperonin. Both stimulated antibodies against pertussis and induced a 42% protection rate against the challenge [Ref1024:Cainelli et al., 2007]. Cpn60 Bordetella pertussis VO_0011035 968920 CDD:171768 CDD:48161 520 ? Cpn60 (GroEL) 4.85 51530.28 547 chaperonin GroEL; Reviewed; PRK12849 >gi|968920|gb|AAA74967.1| Cpn60 (GroEL) [Bordetella pertussis] MAAKQVLFADEARVRIVRGVNVLANAVKTTLGPKGRNVVLERSFGAPTVTKDGVSVAKEIELKDKFENIG AQLVKDVASKTSDNAGDGTTTATVLAQAVVQEGLKYVAAGFNPIDLKRGIDKAVAAAVEELKKLSKPVTT SKEIAQVGSISANSDASIGQIIADAMDKVGKEGVITVEDGKSLENELDVVEGMQFDRGYLSPYFINSPEK QVAALDDPYVLIYDKKVSNIRDLLPVLEQVAKSSRPLLIIAEDVEGEALATLVVNNIRGILKTTAVKAPG FGDRRKAMLEDIAILTGGTVISEETGMSLEKATLQDLGQAKRIEVAKENTTIIDGAGDGKSIEARVKQIR AQIEEATSDYDREKLQERVAKLAGGVAVIRVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALL RAKQAITGLKGDTADQNAGIKLILRAVEEPLRTIVTNAGDEASVVVNTVLNGKGNYGYNAATGEYGDLVE QGVLDPTKVTRTALQNAASVASLLLTAEAAVVELMENKPAAAPAMPGGMGGMGGMDF Protective antigen A soluble fraction obtained from Bordetella pertussis was evaluated as adjuvant for the pertussis component of the Diphtheria-Pertussis-Tetanus (DPT) vaccine. High levels of antibodies were induced, and a 78% protection rate of mice challenged with live B. pertussis was observed. Two proteins were identified as the 73 kDa N-terminal alpha-domain of BrkA autotransporter protein and the Cpn60/60 kDa chaperonin. Both stimulated antibodies against pertussis and induced a 42% protection rate against the challenge [Ref1024:Cainelli et al., 2007]. CyaA Bordetella pertussis VO_0011031 580668 CDD:146244 CDD:111291 CDD:164328 GOA:P15318 UniProtKB/Swiss-Prot:P15318 520 ? adenylate cyclase 1706 Anthrax toxin LF subunit; pfam03497 >gi|580668|emb|CAA01202.1| adenylate cyclase [Bordetella pertussis] MQQSHQAGYANAADRESGIPAAVLDGIKAVAKEKNATLMFRLVNPHSTSLIAEGVATKGLGVHAKSSDWG LQAGYIPVNPNLSKLFGRAPEVIARADNDVNSSLAHGHTAVDLTLSKERLDYLRQAGLVTGMADGVVASN HAGYEQFEFRVKETSDGRYAVQYRRKGGDDFEAVKVIGNAAGIPLTADIDMFAIMPHLSNFRDSARSSVT SGDSVTDYLARTRRAASEATGGLDRERIDLLWKIARAGARSAVGTEARRQFRYDGDMNIGVITDFELEVR NALNRRAHAVGAQDVVQHGTEQNNPFPEADEKIFVVSATGESQMLTRGQLKEYIGQQRGEGYVFYENRAY GVAGKSLFDDGLGAAPGVPSGRSKFSPDVLETVPASPGLRRPSLGAVERQDSGYDSLDGVGSRSFSLGEV SDMAAVEAAELEMTRQVLHAGARQDDAEPGVSGASAHWGQRALQGAQAVAAAQRLVHAIALMTQFGRAGS TNTPQEAASLSAAVFGLGEASSAVAETVSGFFRGSSRWAGGFGVAGGAMALGGGIAAAVGAGMSLTDDAP AGQKAAAGAEIALQLTGGTVELASSIALALAAARGVTSGLQVAGASAGAAAGALAAALSPMEIYGLVQQS HYADQLDKLAQESSAYGYEGDALLAQLYRDKTAAEGAVAGVSAVLSTVGAAVSIAAAASVVGAPVAVVTS LLTGALNGILRGVQQPIIEKLANDYARKIDELGGPQAYFEKNLQARHEQLANSDGLRKMLADLQAGWNAS SVIGVQTTEISKSALELAAITGNADNLKSVDVFVDRFVQGERVAGQPVVLDVAAGGIDIASRKGERPALT FITPLAAPGEEQRRRTKTGKSEFTTFVEIVGKQDRWRIRDGAADTTIDLAKVVSQLVDANGVLKHSIKLD VIGGDGDDVVLANASRIHYDGGAGTNTVSYAALGRQDSITVSADGERFNVRKQLNNANVYREGVATQTTA YGKRTENVQYRHVELARVGQVVEVDTLEHVQHIIGGAGNDSITGNAHDNFLAGGSGDDRLDGGAGNDTLV GGEGQNTVIGGAGDDVFLQDLGVWSNQLDGGAGVDTVKYNVHQPSEERLERMGDTGIHADLQKGTVEKWP ALNLFSVDHVKNIENLHGSRLNDRIAGDDQDNELWGHDGNDTIRGRGGDDILRGGLGLDTLYGEDGNDIF LQDDETVSDDIDGGAGLDTVDYSAMIHPGRIVAPHEYGFGIEADLSREWVRKASALGVDYYDNVRNVENV IGTSMKDVLIGDAQANTLMGQGGDDTVRGGDGDDLLFGGDGNDMLYGDAGNDTLYGGLGDDTLEGGAGND WFGQTQAREHDVLRGGDGVDTVDYSQTGAHAGIAAGRIGLGILADLGAGRVDKLGEAGSSAYDTVSGIEN VVGTELADRITGDAQANVLRGAGGADVLAGGEGDDVLLGGDGDDQLSGDAGRDRLYGEAGDDWFFQDAAN AGNLLDGGDGRDTVDFSGPGRGLDAGAKGVFLSLGKGFASLMDEPETSNVLRNIENAVGSARDDVLIGDA GANVLNGLAGNDVLSGGAGDDVLLGDEGSDLLSGDAGNDDLFGGQGDDTYLFGVGYGHDTIYESGGGHDT IRINAGADQLWFARQGNDLEIRILGTDDALTVHDWYRDADHRVEIIHAANQAVDQAGIEKLVEAMAQYPD PGAAAAAPPAARVPDTLMQSLAVNWR Protective antigen A study demonstrated that passive immunization with specific anti-B. pertussis adenylate cyclase antibodies or active immunization with purified B. pertussis secreted adenylate cyclase (cyaA) protect mice against a lethal respiratory challenge with B. pertussis or B. parapertussis. Results suggest that adenylate cyclase might be the primary cytotoxin responsible for mouse pulmonary lesions during respiratory tract infection with B. pertussis or with the related species B. parapertussis and is a protective antigen of B. pertussis [Ref1019:Guiso et al., 1989]. FhaB Bordetella pertussis VO_0011030 3980256 CDD:141881 GOA:Q45365 HSSP:P12255 InterPro:IPR008619 InterPro:IPR008638 InterPro:IPR010069 UniProtKB/TrEMBL:Q45365 520 ? filamentous hemagglutinin 9.35 332802.28 3590 haemagglutination activity domain; cl05436 >gi|3980256|emb|CAA36409.1| filamentous hemagglutinin [Bordetella pertussis] MNTNLYRLVFSHVRGMLVPVSEHCTVGNTFCGRTRGQARSGARATSLSVAPNALAWALMLACTGLPLVTH AQGLVPQGQTQVLQGGNKVPVVNIADPNSGGVSHNKFQQFNVANPGVVFNNGLTDGVSRIGGALTKNPNL TRQASAILAEVTDTSPSRLAGTLEVYGKGADLIIANPNGISVNGLSTLNASNLTLTTGRPSVNGGRIGLD VQQGTVTIERGGVNATGLGYFDVVARLVKLQGAVSSKQGKPLADIAVVAGANRYDHATRRATPIAAGARG AAAGAYAIDGTAAGAMYGKHITLVSSDSGLGVRQLGSLSSPSAITVSSQGEIALGDATVQRGPLSLKGAG VVSAGKLASGGGAVNVAGGGAVKIASASSVGNLAVQGGGKVQATLLNAGGTLLVSGRQAVQLGAASSRQA LSVNAGGALKADKLSATRRVDVDGKQAVALGSASSNALSVRAGGALKAGKLSATGRLDVDGKQAVTLGSV ASDGALSVSAGGNLRANELVSSAQLEVRGQREVALDDASSARGMTVVAAGALAARNLQSKGAIGVQGGEA VSVANANSDAELRVRGRGQVDLHDLSAARGADISGEGRVNIGRARSDSDVKVSAHGALSIDSMTALGAIG VQAGGSVSAKDMRSRGAVTVSGGGAVNLGDVQSDGQVRATSAGAMTVRDVAAAADLALQAGDALQAGFLK SAGAMTVNGRDAVRLDGAHAGGQLRVSSDGQAALGSLAAKGELTVSAARAATVAELKSLDNISVTGGERV SVQSVNSASRVAISAHGALDVGKVSAKSGIGLEGWGAVGADSLGSDGAISVSGRDAVRVDQARSLADISL GAEGGATLGAVEAAGSIDVRGGSTVAANSLHANRDVRVSGKDAVRVTAATSGGGLHVSSGRQLDLGAVQA RGALALDGGAGVALQSAKASGTLHVQGGEHLDLGTLAAVGAVDVNGTGDVRVAKLVSDAGADLQAGRSMT LGIVDTTGDLQARAQQKLELGSVKSDGGLQAAAGGALSLAAAEVAGALELSGQGVTVDRASASRARIDST GSVGIGALKAGAVEAASPRRARRALRQDFFTPGSVVVRAQGNVTVGRGDPHQGVLAQGDIIMDAKGGTLL LRNDALTENGTVTISADSAVLEHSTIESKISQSVLAAKGDKGKPAVSVKVAKKLFLNGTLRAVNDNNETM SGRQIDVVDGRPQITDAVTGEARKDESVVSDAALVADGGPIVVEAGELVSHAGGIGNGRNKENGASVTVR TTGNLVNKGYISAGKQGVLEVGGALTNEFLVGSDGTQRIEAQRIENRGTFQSQAPAGTAGALVVKAAEAI VHDGVMATKGEMQIAGKGGGSPTVTAGAKATTSANKLSVDVASWDNAGSLDIKKGGAQVTVAGRYAEHGE VSIQGDYTVSADAIALAAQVTQRGGAANLTSRHDTRFSNKIRLMGPLQVNAGGPVSNTGNLKVREGVTVT AASFDNETGAEVMAKSATLTTSGAARNAGKMQVKEAATIVAASVSNPGTFTAGKDITVTSRGGFDNEGKM ESNKDIVIKTEQFSNGRVLDAKHDLTVTASGQADNRGSLKAGHDFTVQAQRIDNSGTMAAGHDATLKAPH LRNTGQVVAGHDIHIINSAKLENTGRVDARNDIALDVADFTNTGSLYAEHDATLTLAQGTQRDLVVDQDH ILPVAEGTLRVKAKSLTTEIETGNPGSLIAEVQENIDNKQAIVVGKDLTLSSAHGNVANEANALLWAAGE LTVKAQNITNKRAALIEAGGNARLTAAVALLNKLGRIRAGEDMHLDAPRIENTAKLSGEVQRKGVQDVGG GEHGRWSGIGYVNYWLRAGNGKKAGTIAAPWYGGDLTAEQSLIEVGKDLYLNAGARKDEHRHLLNEGVIQ AGGHGHIGGDVDNRSVVRTVSAMEYFKTPLPVSLTALDNRAGLSPATWNFQSTYELLDYLLDQNRYEYIW GLYPTYTEWSVNTLKNLDLGYQAKPAPTAPPMPKAPELDLRGHTLESAEGRKIFGEYKKLQGEYEKAKMA VQAVEAYGEATRRVHDQLGQRYGKALGGMDAETKEVDGIIQEFAADLRTVYAKQADQATIDAETDKVAQR YKSQIDAVRLQAIQPGRVTLAKALSAALGADWRALGHSQLMQRWKDFKAGKRGAEIAFYPKEQTVLAAGA GLTLSNGAIHNGENAAQNRGRPEGLKIGAHSATSVSGSFDALRDVGLEKRLDIDDALAAVLVNPHIFTRI GAAQTSLADGAAGPALARQARQAPETDGMVDARGLGSADALASLASLDAAQGLEVSGRRNAQVADAGLAG PSAVAAPAVGAADVGVEPVTGDQVDQPVVAVGLEQPVATVRVAPPAVALPRPLFETRIKFIDQSKFYGSR YFFEQIGYKPDRAARVAGDNYFDTTLVREQVRRALGGYESRLPVRGVALVAKLMDSAGTVGKALGLKVGV APTAQQLKQADRDFVWYVDTVIDGQKVLAPRLYLTEATRQGITDQYAGGGALIASGGDVTVNTDGHDVSS VNGLIQGRSVKVDAGKGKVVVADSKGAGGGIEADDEVDVSGRDIGIEGGKLRGKDVRLKADTVKVATSMR YDDKGRLAARGDGALDAQGGQLHIEAKRLETAGATLKGGKVKLDVDDVKLGGVYEAGSSYENKSSTPLGS LFAILSSTTETNQSAHANHYGTRIEAGTLEGKMQNLEIEGGSVDAAHTDLSVARDARFKAAADFAHAEHE KDVRQLSLGAKVGAGGYEAGFSLGSESGLEAHAGRGMTAGAEVKVGYRASHEQSSETEKSYRNANLNFGG GSVEAGNVLDIGGADINRNRYGGAAKGNAGTEEALRMRAKKVESTKYVSEQTSQSSGWSVEVASTASARS SLLTAATRLGDSVAQNVEDGREIRGELMAAQVAAEATQLVTADTAAVALSAGISADFDSSHSRSTSQNTQ YLGGNLSIEATEGDATLVGAKFGGGDQVSLKAAKSVNLMAAESTFESYSESHNFHASADANLGANAVQGA VGLGLTAGMGTSHQITNETGKTYAGTSVDAANVSIDAGKDLNLSGSRVRGKHVVLDVEGDINATSKQDER NYNSSGGGWDASAGVAIQNRTLVAPVGSAGFNFNTEHDNSRLTNDGAAGVVASDGLTGHVKGDANLTGAT IADLSGKGNLKVDGAVNAQNLKDYRDKDGGSGGLNVGISSTTLAPTVGVAFGRVAGEDYQAEQRATIDVG QTKDPARLQVGGGVKGTLNQDAAQATVVQRNKHWAGGGSEFSVAGKSLKKKNQVRPVETPTPDVVDGPPS RPTTPPASPQPIRATVEVSSPPPVSVATVEVVPRPKVETGSAASASAGGAQVVPVTPPKVEVAKVEVVPR PKVETAQPLPPRPVVAEKVTTPAVQPQLAKVETVQPVKPETTKPLPKPLPVAKVTKAPPPVVETAQPLPP VKPQKATPGPVAEVGKATVTTVQVQSAPPKPAPVAKQPAPAPKPKPKPKPKAERPKPGKTTPLSGRHVVQ QQVQVLQRQASDINNTKSLPGGKLPKPVTVKLTDENGKPQTYTINRREDLMKLNGKVLSTKTTLGLEQTF RLRVEDIGGKNYRVFYETNK Protective antigen A combination of the 69-kDa outer membrane protein and filamentous hemagglutinin (fhaB), both isolated from lymphocytosis promoting factor (LPF; pertussis toxin) minus mutants of Bordetella pertussis, is protective in the mouse intracerebral challenge potency (Kendrick) test [Ref1017:Novotny et al., 1991]. Prn Bordetella pertussis Tohama I VO_0011033 2664290 33592195 BP1054 BX640414 NP_879839 257313 1098090 1100822 + pertactin precursor 9.61 86606.91 910 Identical to the previously sequenced Bordetella pertussis pertactin precursor Prn or Omp69A SW:PERT_BORPE (P14283) (910 aa) fasta scores: E(): 0, 100% id in 910 aa, and to Bordetella bronchiseptica pertactin precursor Prn SW:PERT_BORBR (Q03035) (911 aa) fasta scores: E(): 1.4e-160, 91.31% id in 921 aa >gi|33591275:1098090-1100822 Bordetella pertussis Tohama I, complete genome AATGAACATGTCTCTGTCACGCATTGTCAAGGCGGCGCCCCTGCGCCGCACCACGCTGGCCATGGCGCTG GGCGCGCTGGGCGCCGCCCCGGCGGCGCATGCCGACTGGAACAACCAGTCCATCGTCAAGACCGGTGAGC GCCAGCATGGCATCCATATCCAGGGCTCCGACCCGGGCGGCGTACGGACCGCCAGCGGAACCACCATCAA GGTAAGCGGCCGTCAGGCCCAGGGCATCCTGCTAGAAAATCCCGCGGCCGAGCTGCAGTTCCGGAACGGC AGTGTCACGTCGTCGGGACAGTTGTCCGACGATGGCATCCGGCGCTTTCTGGGCACCGTCACCGTCAAGG CCGGCAAGCTGGTCGCCGATCACGCCACGCTGGCCAACGTTGGCGACACCTGGGACGACGACGGCATCGC GCTCTATGTGGCCGGCGAACAGGCCCAGGCCAGCATCGCCGACAGCACCCTGCAGGGCGCTGGCGGCGTG CAGATCGAGCGCGGCGCCAATGTCACGGTCCAACGCAGCGCCATCGTCGACGGGGGCTTGCATATCGGCG CCCTGCAGTCATTGCAGCCGGAAGACCTTCCGCCCAGCCGGGTGGTGCTGCGCGACACCAACGTGACCGC CGTGCCCGCCAGCGGCGCGCCCGCGGCGGTGTCTGTGTTGGGGGCCAGTGAGCTTACGCTCGACGGCGGG CACATCACCGGCGGGCGGGCAGCGGGGGTGGCGGCCATGCAAGGGGCGGTCGTGCATCTGCAGCGCGCGA CGATACGGCGCGGGGACGCGCCTGCCGGCGGTGCGGTTCCCGGCGGTGCGGTTCCCGGTGGTGCGGTTCC CGGCGGCTTCGGTCCCGGCGGCTTCGGTCCCGTCCTCGACGGCTGGTATGGCGTGGACGTATCGGGCTCC AGCGTGGAGCTCGCCCAGTCGATCGTCGAGGCGCCGGAGCTGGGCGCCGCAATCCGGGTGGGCCGCGGCG CCAGGGTGACGGTGTCGGGCGGCAGCTTGTCCGCACCGCACGGCAATGTCATCGAGACCGGCGGCGCGCG TCGCTTTGCGCCTCAAGCCGCGCCCCTGTCGATCACCTTGCAGGCCGGCGCGCATGCCCAGGGGAAAGCG CTGCTGTACCGGGTCCTGCCGGAGCCCGTGAAGCTGACGCTGACCGGGGGCGCCGATGCGCAGGGCGACA TCGTCGCGACGGAGCTGCCCTCCATTCCCGGCACGTCGATCGGGCCGCTCGACGTGGCGCTGGCCAGCCA GGCCCGATGGACGGGCGCTACCCGCGCGGTCGACTCGCTGTCCATCGACAACGCCACCTGGGTCATGACG GACAACTCGAACGTCGGTGCGCTACGGCTGGCCAGCGACGGCAGCGTCGATTTCCAGCAGCCGGCCGAAG CTGGGCGGTTCAAGGTCCTGACGGTCAATACGCTGGCGGGTTCGGGGCTGTTCCGCATGAATGTCTTCGC GGACCTGGGGCTGAGCGACAAGCTGGTCGTCATGCAGGACGCCAGCGGCCAGCACAGGCTGTGGGTCCGC AACAGCGGCAGCGAGCCGGCCAGCGCCAACACCCTGCTGCTGGTGCAGACGCCACTAGGCAGCGCGGCGA CCTTTACCCTTGCCAACAAGGACGGCAAGGTCGATATCGGTACCTATCGCTATCGATTGGCCGCCAACGG CAATGGGCAGTGGAGCCTGGTGGGCGCGAAGGCGCCGCCGGCGCCCAAGCCCGCGCCGCAGCCGGGTCCC CAGCCGCCGCAGCCGCCGCAGCCGCAGCCGGAAGCGCCGGCGCCGCAACCGCCGGCGGGCAGGGAGTTGT CCGCCGCCGCCAACGCGGCGGTCAACACGGGTGGGGTGGGCCTGGCCAGCACGCTCTGGTACGCCGAAAG CAATGCGTTGTCCAAGCGCCTGGGCGAGTTGCGCCTGAATCCGGACGCCGGCGGCGCCTGGGGCCGCGGC TTCGCGCAACGCCAGCAGCTGGACAACCGCGCCGGGCGGCGCTTCGACCAGAAGGTGGCCGGCTTCGAGC TGGGCGCCGACCACGCGGTGGCGGTGGCCGGCGGACGCTGGCACCTGGGCGGGCTGGCCGGCTATACGCG CGGCGACCGCGGCTTCACCGGCGACGGCGGCGGCCACACCGACAGCGTGCATGTCGGGGGCTATGCCACA TATATCGCCGACAGCGGTTTCTACCTGGACGCGACGCTGCGCGCCAGCCGCCTGGAGAATGACTTCAAGG TGGCGGGCAGCGACGGGTACGCGGTCAAGGGCAAGTACCGCACCCATGGGGTGGGCGCCTCGCTCGAGGC GGGCCGGCGCTTTACCCATGCCGACGGCTGGTTCCTCGAGCCGCAGGCCGAGCTGGCGGTATTCCGGGCC GGCGGCGGTGCGTACCGCGCGGCCAACGGCCTGCGGGTGCGCGACGAAGGCGGCAGCTCGGTGCTGGGTC GCCTGGGCCTGGAGGTCGGCAAGCGCATCGAACTGGCAGGCGGCAGGCAGGTGCAGCCATACATCAAGGC CAGCGTGCTGCAGGAGTTCGACGGCGCGGGTACGGTACACACCAACGGCATCGCGCACCGCACCGAACTG CGCGGCACGCGCGCCGAACTGGGCCTGGGCATGGCCGCCGCGCTGGGCCGCGGCCACAGCCTGTATGCCT CGTACGAGTACTCCAAGGGCCCGAAGCTGGCCATGCCGTGGACCTTCCACGCGGGCTACCGGTACAGCTG GTA >gi|33592195|ref|NP_879839.1| pertactin precursor [Bordetella pertussis Tohama I] MNMSLSRIVKAAPLRRTTLAMALGALGAAPAAHADWNNQSIVKTGERQHGIHIQGSDPGGVRTASGTTIK VSGRQAQGILLENPAAELQFRNGSVTSSGQLSDDGIRRFLGTVTVKAGKLVADHATLANVGDTWDDDGIA LYVAGEQAQASIADSTLQGAGGVQIERGANVTVQRSAIVDGGLHIGALQSLQPEDLPPSRVVLRDTNVTA VPASGAPAAVSVLGASELTLDGGHITGGRAAGVAAMQGAVVHLQRATIRRGDAPAGGAVPGGAVPGGAVP GGFGPGGFGPVLDGWYGVDVSGSSVELAQSIVEAPELGAAIRVGRGARVTVSGGSLSAPHGNVIETGGAR RFAPQAAPLSITLQAGAHAQGKALLYRVLPEPVKLTLTGGADAQGDIVATELPSIPGTSIGPLDVALASQ ARWTGATRAVDSLSIDNATWVMTDNSNVGALRLASDGSVDFQQPAEAGRFKVLTVNTLAGSGLFRMNVFA DLGLSDKLVVMQDASGQHRLWVRNSGSEPASANTLLLVQTPLGSAATFTLANKDGKVDIGTYRYRLAANG NGQWSLVGAKAPPAPKPAPQPGPQPPQPPQPQPEAPAPQPPAGRELSAAANAAVNTGGVGLASTLWYAES NALSKRLGELRLNPDAGGAWGRGFAQRQQLDNRAGRRFDQKVAGFELGADHAVAVAGGRWHLGGLAGYTR GDRGFTGDGGGHTDSVHVGGYATYIADSGFYLDATLRASRLENDFKVAGSDGYAVKGKYRTHGVGASLEA GRRFTHADGWFLEPQAELAVFRAGGGAYRAANGLRVRDEGGSSVLGRLGLEVGKRIELAGGRQVQPYIKA SVLQEFDGAGTVHTNGIAHRTELRGTRAELGLGMAAALGRGHSLYASYEYSKGPKLAMPWTFHAGYRYSW Protective antigen Researchers constructed isogenic mutants of B. pertussis Tohama expressing the alleles ptxA1 or ptxA2 and prn1 or prn2 and compared the efficacies of an acellular pertussis vaccine against the mutants in a mouse model. While the vaccine was effective against all of the B. pertussis strains regardless of the allele expression pattern, the strain expressing ptxA1 and prn2 displayed a survival advantage over the other strains [Ref1021:Komatsu et al., 2010]. PtxA Bordetella pertussis Tohama I VO_0011034 2665068 33594638 BP3783 BX640422 NP_882282 257313 3988257 3989066 + toxin subunit 1 7.54 27989.63 269 Previously sequenced as Bordetella pertussis pertussis toxin subunit 1 precursor, NAD-dependent ADP-ribosyltransferase, PtxA SW:TOX1_BORPE (P04977) (269 aa) fasta scores: E(): 1.5e-110, 100% id in 269 aa >gi|33591275:3988257-3989066 Bordetella pertussis Tohama I, complete genome GATGCGTTGCACTCGGGCAATTCGCCAAACCGCAAGAACAGGCTGGCTGACGTGGCTGGCGATTCTTGCC GTCACGGCGCCCGTGACTTCGCCGGCATGGGCCGACGATCCTCCCGCCACCGTATACCGCTATGACTCCC GCCCGCCGGAGGACGTTTTCCAGAACGGATTCACGGCGTGGGGAAACAACGACAATGTGCTCGACCATCT GACCGGACGTTCCTGCCAGGTCGGCAGCAGCAACAGCGCTTTCGTCTCCACCAGCAGCAGCCGGCGCTAT ACCGAGGTCTATCTCGAACATCGCATGCAGGAAGCGGTCGAGGCCGAACGCGCCGGCAGGGGCACCGGCC ACTTCATCGGCTACATCTACGAAGTCCGCGCCGACAACAATTTCTACGGCGCCGCCAGCTCGTACTTCGA ATACGTCGACACTTATGGCGACAATGCCGGCCGTATCCTCGCCGGCGCGCTGGCCACCTACCAGAGCGAA TATCTGGCACACCGGCGCATTCCGCCCGAAAACATCCGCAGGGTAACGCGGGTCTATCACAACGGCATCA CCGGCGAGACCACGACCACGGAGTATTCCAACGCTCGCTACGTCAGCCAGCAGACTCGCGCCAATCCCAA CCCCTACACATCGCGAAGGTCCGTAGCGTCGATCGTCGGCACATTGGTGCGCATGGCGCCGGTGATAGGC GCTTGCATGGCGCGGCAGGCCGAAAGCTCCGAGGCCATGGCAGCCTGGTCCGAACGCGCCGGCGAGGCGA TGGTTCTCGTGTACTACGAAAGCATCGCGTATTCGTTCTA >gi|33594638|ref|NP_882282.1| toxin subunit 1 [Bordetella pertussis Tohama I] MRCTRAIRQTARTGWLTWLAILAVTAPVTSPAWADDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHL TGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFE YVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPN PYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF Protective antigen BALB/c mice were immunized with PTx vaccine on day 6 of life and then challenged with B. pertussis using the aerosol challenge model. These primed mice were significantly better protected against leukocytosis, weight loss, and proliferation of B. pertussis in the lungs following aerosol challenge than the nonprimed group. This protection correlated with levels of anti-PT antibody in serum present on the day of aerosol challenge [Ref1025:Bruss and Siber, 2002]. PtxB Bordetella pertussis VO_0011037 225311180 CDD:112265 CDD:145854 GOA:C0MPK7 UniProtKB/TrEMBL:C0MPK7 520 ? pertussis toxin subunit 2 precursor 8.44 23409.78 226 Aerolysin/Pertussis toxin (APT) domain; pfam03440 >gi|225311180|emb|CAX52304.1| pertussis toxin subunit 2 precursor [Bordetella pertussis] MPIDRKTLCHLLSVLPLALLGSHVARASTPGIVIPPQEQITQHGGPYGRCANKTRALTVAELRGSGDLQE YLRHVTRGWSIFALYDGTYLGGEYGGVIKDGTPGGAFDLKTTFCIMTTRNTGQPATDHYYSNVTATRLLS STNSRLCAVFVRSGQPVIGACTSPYDGKYWSMYSRLRKMLYLIYVAGISVRVHVSKEEQYYDYEDATFET YALTGISICNPGSSLC Protective antigen BALB/c mice were immunized with PTx vaccine on day 6 of life and then challenged with B. pertussis using the aerosol challenge model. These primed mice were significantly better protected against leukocytosis, weight loss, and proliferation of B. pertussis in the lungs following aerosol challenge than the nonprimed group. This protection correlated with levels of anti-PT antibody in serum present on the day of aerosol challenge [Ref1025:Bruss and Siber, 2002]. PtxC Bordetella pertussis VO_0011038 225311183 CDD:112265 CDD:145854 GOA:Q546I1 InterPro:IPR005138 UniProtKB/TrEMBL:Q546I1 520 ? pertussis toxin subunit 3 precursor 8.87 23895.72 227 Aerolysin/Pertussis toxin (APT) domain; pfam03440 >gi|225311183|emb|CAX52307.1| pertussis toxin subunit 3 precursor [Bordetella pertussis] MLINNKKLLHHILPILVLALLGMRTAQAVAPGIVIPPKALFTQQGGAYGRCPNGTRALTVAELRGNAELQ TYLRQITPGWSIYGLYDGTYLGQAYGGIIKDAPPGAGFIYRETFCITTIYKTGQPAADHYYSKVTATRLL ASTNSRLCAVFVRDGQSVIGACASPYEGRYRDMYDALRRLLYMIYMSGLAVRVHVSKEEQYYDYEDATFQ TYALTGISLCNPAASIC Protective antigen BALB/c mice were immunized with PTx vaccine on day 6 of life and then challenged with B. pertussis using the aerosol challenge model. These primed mice were significantly better protected against leukocytosis, weight loss, and proliferation of B. pertussis in the lungs following aerosol challenge than the nonprimed group. This protection correlated with levels of anti-PT antibody in serum present on the day of aerosol challenge [Ref1025:Bruss and Siber, 2002]. PtxD Bordetella pertussis VO_0011032 225311181 CDD:90471 GOA:C0MPK8 UniProtKB/TrEMBL:C0MPK8 520 ? pertussis toxin subunit 4 precursor 10.99 15253.97 152 Pertussis toxin S4 subunit; pfam09275 >gi|225311181|emb|CAX52305.1| pertussis toxin subunit 4 precursor [Bordetella pertussis] MLRRFPTRTTAPGQGGARRSRVRALAWLLASGAMTHLSPALADVPYVLVKTNMVVTSVAMKPYEVTPTRM LVCGIAAKLGAAASSPDAHVPFCFGKDLKRPGSSPMEVMLRAVFMQQRPLRMFLGPKQLTFEGKPALELI RMVECSGKQDCP Protective antigen BALB/c mice were immunized with PTx vaccine on day 6 of life and then challenged with B. pertussis using the aerosol challenge model. These primed mice were significantly better protected against leukocytosis, weight loss, and proliferation of B. pertussis in the lungs following aerosol challenge than the nonprimed group. This protection correlated with levels of anti-PT antibody in serum present on the day of aerosol challenge [Ref1025:Bruss and Siber, 2002]. PtxE Bordetella pertussis VO_0011039 225311182 CDD:117820 GOA:C0MPK9 UniProtKB/TrEMBL:C0MPK9 520 ? pertussis toxin subunit 5 precursor 6.5 14003.11 133 Pertussis toxin S5 subunit; pfam09276 >gi|225311182|emb|CAX52306.1| pertussis toxin subunit 5 precursor [Bordetella pertussis] MQRQAGLPLKANPMHTIASILLSVLGIYSPADVAGLPTHLYKNFTVQELALKLKGKNQEFCLTAFMSGRS LVRACLSDAGHEHDTWFDTMLGFAISAYALKSRIALTVEDSPYPGTPGDLLELQICPLNGYCE Protective antigen BALB/c mice were immunized with PTx vaccine on day 6 of life and then challenged with B. pertussis using the aerosol challenge model. These primed mice were significantly better protected against leukocytosis, weight loss, and proliferation of B. pertussis in the lungs following aerosol challenge than the nonprimed group. This protection correlated with levels of anti-PT antibody in serum present on the day of aerosol challenge [Ref1025:Bruss and Siber, 2002]. TcfA Bordetella pertussis 282766137 CDD:154874 520 ? tracheal colonization factor 5.91 62423.78 631 Autotransporter beta-domain; cl02365 >gi|282766137|gb|ADA85103.1| tracheal colonization factor [Bordetella pertussis] MHIYGNMNRATPCRGAVRALALALLGAGMWTLSPPSAWALKLPSLLTDDELKLVLPTGMSLEDFKRSLQE SAPSALATPPSSSPPVAKPGPGSVAEAPSGSGHKDNPSPPVVGVGPGMAESSGGHNPGVGGGTHENGLPG IGKVGGSAPGPDTSTGSGPDAGMASGAGSTSPGASGGAGKDAMPPSEGERPDSGMSDSGRGGESSAGGLN PDGAGKPPREEGEPGSKSPADGGQDGPPPPRDGGDADPQPPRDDGNGEQQPPKGGGDEGQRPPPAAGNGG NGGNGNAQLPERGDDAGPKPPEGEGGDEGPQPPQGGGEQDAPEVPPVAPAPPAGNGVYDPGTHTLTTPAS AAVSLASSSHGVWQAEMNALSKRMGELRLTPVAGGVWGRAFGRRQDVDNRVSREFRQTISGFELGADTAL PVADGRWHVGAVAGYTNGRIKFDRGGTGDDDSVHVGAYATYIEDGGFYMDGIVRVSRIRHAFKVDDAKGR RVRGQYRGNGVGASLELGKRFTWPGAWYVEPQLEVAAFHAQGADYTASNGLRIKDDGTNSMLGRLGLHVG RQFDLGDGRVVQPYMKLSWVQEFDGKGTVRTNDIRHKVRLDGGRTELAVGVASQLGKHGSLFGSYEYAKG S Other Intranasal administration of IEM101 expressing Tcf induced a significant reduction in bacterial colonization of the tracheas of mice challenged with wild-type B. pertussis. These data are in agreement with the putative role of Tcf in Bordetella tracheal colonization [Ref1027:Chen et al., 1998]. Bruss and Siber, 2002 journal Bruss JB, Siber GR 2002 70 8 4600-4608 Infection and immunity Cainelli et al., 2007 journal Cainelli Gebara VC, Risoléo L, Lopes AP, Ferreira VR, Quintilio W, Lépine F, Silva WD, Raw I 2007 25 4 621-629 Vaccine Chen et al., 1998 journal Chen I, Finn TM, Yanqing L, Guoming Q, Rappuoli R, Pizza M 1998 66 4 1648-1653 Infection and immunity FDA: Adacel website http://www.fda.gov/BiologicsBloodVaccines/Vaccines/ApprovedProducts/ucm172481.htm FDA: Boostrix website http://www.fda.gov/cber/label/boostrixLB.pdf FDA: DAPTACEL website http://www.fda.gov/BiologicsBloodVaccines/Vaccines/ApprovedProducts/ucm101572.htm FDA: Infanrix website http://www.fda.gov/BiologicsBloodVaccines/Vaccines/ApprovedProducts/ucm101568.htm FDA: Pediarix website http://www.fda.gov/cber/label/dtapgsk031607LB.pdf FDA: Pentacel website http://www.fda.gov/BiologicsBloodVaccines/Vaccines/ApprovedProducts/ucm172502.htm FDA: Tripedia website http://www.fda.gov/BiologicsBloodVaccines/Vaccines/ApprovedProducts/ucm101565.htm Fennelly et al., 2008 journal Fennelly NK, Sisti F, Higgins SC, Ross PJ, van der Heide H, Mooi FR, Boyd A, Mills KH 2008 76 3 1257-1266 Infection and immunity Guiso et al., 1989 journal Guiso N, Rocancourt M, Szatanik M, Alonso JM 1989 7 5 373-380 Microbial pathogenesis Kinnear et al., 2001 journal Kinnear SM, Marques RR, Carbonetti NH 2001 69 4 1983-1993 Infection and immunity Komatsu et al., 2010 journal Komatsu E, Yamaguchi F, Abe A, Weiss AA, Watanabe M 2010 17 5 807-812 Clinical and vaccine immunology : CVI Merkel et al., 1998 journal Merkel TJ, Stibitz S, Keith JM, Leef M, Shahin R 1998 66 9 4367-4373 Infection and immunity Novotny et al., 1985 journal Novotny P, Chubb AP, Cownley K, Montaraz JA, Beesley JE 1985 61 27-41 Developments in biological standardization Novotny et al., 1991 journal Novotny P, Chubb AP, Cownley K, Charles IG 1991 164 1 114-122 The Journal of infectious diseases Sato and Sato, 1984 journal Sato H, Sato Y 1984 46 2 415-421 Infection and immunity Sukumar et al., 2007 journal Sukumar N, Mishra M, Sloan GP, Ogi T, Deora R 2007 189 10 3695-3704 Journal of bacteriology Wiki: Bordetella pertussis website http://en.wikipedia.org/wiki/Bordetella_pertussis