|
Rabbit hemorrhagic disease virus |
Table of Contents |
- General Information
- NCBI Taxonomy ID
- Disease
- Introduction
- Host Ranges and Animal Models
- Vaccine Related Pathogen Genes
- ORF1
(Protective antigen)
- Vaccine Information
- ALVAC-RHDV (vCP309)
- RHDV DNA vaccine pcDNA-VP60
- rORFV-RHDV-VP60
- References
|
I. General Information |
1. NCBI Taxonomy ID: |
11976 |
2. Disease: |
Rabbit hemorrhagic disease |
3. Introduction |
Rabbit haemorrhagic disease (RHD), also known as rabbit calicivirus disease (RCD) or viral haemorrhagic disease (VHD), is a highly infectious and often fatal disease that affects wild and domestic rabbits of the species Oryctolagus cuniculus. The infectious agent responsible for the disease is rabbit haemorrhagic disease virus (RHDV), or rabbit calicivirus (RCV), genus Lagovirus of the family Caliciviridae. The virus infects only rabbits, and has been used in some countries to control rabbit populations (Wiki: Rabbit haemorrhagic disease). |
4. Host Ranges and Animal Models |
Rabbits |
II. Vaccine Related Pathogen Genes |
1. ORF1 |
-
Gene Name :
ORF1
-
Sequence Strain (Species/Organism) :
Rabbit hemorrhagic disease virus
-
NCBI Protein GI :
515625
-
Other Database IDs :
CDD:279283
CDD:165513 GOA:Q86119 InterPro: IPR000317 InterPro: IPR000605 InterPro: IPR001205 InterPro: IPR003593 InterPro: IPR004004 InterPro: IPR004005 InterPro: IPR007094 InterPro: IPR009003 InterPro: IPR014759 UniProtKB/UniProt: Q86119
-
Taxonomy ID :
11976
-
Gene Strand (Orientation) :
?
-
Protein Name :
VP60
-
Protein pI :
4.97
-
Protein Weight :
55535.12
-
Protein Length :
641
-
Protein Note :
Calicivirus coat protein; pfam00915
-
Protein Sequence : Show Sequence
>CAA80883.1 VP60 [Rabbit hemorrhagic disease virus]
MEGKARTAPQGEAAGTATTASVPGTTTDGMDPGVVATTSVVTAENSSASIATAGIGGPPQQVDQQETWRT
NFYYNDVFTWSVADAPGSILYTVQHSPQNNPFTAVLSQMYAGWAGGMQFRFIVAGIGVFGGRLVAAVIPP
GIEIGPGLEVRQFPHVVIDARSLEPVTITMPDLRPNMYHPTGDPGLVPTLVLSVYNNLINPFGGSTSAIQ
VTVETRPSEDFEFVMIRAPSSKTVDSISPAGLLTTPVLTGVGNDNRWNGQIVGLQPVPGGFSTCNRHWNL
NGSTYGWSSPRFGDIGHRRGSASYPGNNATNVLQFWYANAGSAIDNPISQVAPDGFPDMSFVPFNGPGIP
AAGWVGFGAIWNSNSGAPNVTTVQAYELGFATGAPGNLQPTTNTSGSQTVAKSIYAVVTGTAQNPAGLFV
MASGVISTPSANAITYTPQPDRIVTTPGTPAAAPVGKNTPIMFASVVRRTGDVNATAGSANGTQYGTGSQ
PLPVTIGLSLNNYSSALMPGQFFVWQLTFASGFMEIGLSVDGYFYAGTGASTTLIDLTELIDVRPVGPRP
SKSTLVFNLGGTANGFSYV
-
Molecule Role :
Protective antigen
- Related Vaccine(s):
RHDV DNA vaccine pcDNA-VP60
,
rORFV-RHDV-VP60
|
III. Vaccine Information |
 |
|
 |
|
|
|
1. ALVAC-RHDV (vCP309) |
a. Vaccine Ontology ID: |
VO_0004738 |
b. Type: |
Recombinant vector vaccine |
c. Status: |
Research |
d. Host Species for Licensed Use: |
Baboon |
e. Preparation |
An ALVAC (canarypox)-based recombinant virus ALVAC-RHDV (vCP309) expressing a native rabbit hemorrhagic disease virus (RHDV) capsid protein was derived and assessed for its protective efficacy in rabbits (Fischer et al., 1997). |
f. Immunization Route |
Intramuscular injection (i.m.) |
g.
Rabbit Response |
- Vaccination Protocol:
Rabbits were inoculated with varying doses of vCP309 (Fischer et al., 1997).
- Vaccine Immune Response Type:
VO_0003057
- Challenge Protocol:
Rabbits were challenged with RHDV (Fischer et al., 1997).
- Efficacy:
Protection against a lethal RHDV challenge was demonstrated in rabbits inoculated twice with either high (10(7) p.f.u.) or low (10(5) p.f.u.) doses of vCP309. However, animals in the high dose group developed significantly higher antibody response (Fischer et al., 1997).
|
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
2. RHDV DNA vaccine pcDNA-VP60 |
a. Vaccine Ontology ID: |
VO_0004577 |
b. Type: |
DNA vaccine |
c. Status: |
Research |
d. Host Species as Laboratory Animal Model: |
Rabbits |
e. Gene Engineering of
ORF1 |
- Type:
DNA vaccine construction
- Description:
- Detailed Gene Information: Click here.
|
f. Vector: |
pcDNA3.1(+) (Yuan et al., 2013) |
g. Immunization Route |
Intramuscular injection (i.m.) |
h.
Rabbit Response |
- Vaccine Immune Response Type:
VO_0003057
- Immune Response:
In all cases, the rabbits immunized with pcDNA-VP60 developed high level of RHDV-specific antibodies and cellular immune response (Yuan et al., 2013).
- Efficacy:
The rabbits inoculated with PBS and pcDNA3.1(+) were not protected from the RHDV challenge and developed high fever and oronasal hemorrhage, and died within two days after challenge as a consequence of the viral infection. All pcDNA-VP60 and RHDV inactive vaccine vaccinated rabbits survived (Yuan et al., 2013).
|
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
3. rORFV-RHDV-VP60 |
a. Vaccine Ontology ID: |
VO_0004767 |
b. Type: |
Recombinant vector vaccine |
c. Status: |
Research |
d. Host Species for Licensed Use: |
Rabbit |
e. Gene Engineering of
ORF1 |
- Type:
Recombinant protein preparation
- Description:
Recombinant Orf virus (ORFV; Parapoxvirus) expressing the major capsid protein VP1 (VP60) of the calicivirus, rabbit hemorrhagic disease virus (RHDV) (Rohde et al., 2011).
- Detailed Gene Information: Click here.
|
f. Preparation |
(Rohde et al., 2011) Anew recombinant Orf virus (ORFV; Parapoxvirus) expressing the major capsid protein VP1 (VP60) of RHDV. |
g. Immunization Route |
Intramuscular injection (i.m.) |
h.
Rabbit Response |
- Vaccination Protocol:
The animals were immunized once, twice or 3-times by the intramuscular (i.m.) route with 1 ml D1701-V-VP1 containing 107 PFU (plaque-forming units), 106 PFU, or 105 PFU, respectively. For controls, groups of rabbits were vaccinated with the commercial RHDV vaccine “RIKA-VACC” (Riemser Arzneimittel AG, Germany) or remained non-vaccinated (Rohde et al., 2011).
- Vaccine Immune Response Type:
VO_0003057
- Challenge Protocol:
Twenty two days after the last vaccination, the animals were inoculated i.m. with 1 ml containing 104 LD50 (lethal dose 50) of the virulent RHDV strain “Eisenhüttenstadt” (Rohde et al., 2011).
- Efficacy:
All animals immunized with the ORFV-vectored vaccine survived without any clinical signs, similar to animals control immunized with the commercially available inactivated RHDV vaccine RIKA-VACC. As expected, all non-immunized rabbits died within 48 h after challenge with RHD-specific clinical symptoms (Rohde et al., 2011).
|
|
|
|
 |
|
 |
|
|
IV. References |
1. Fischer et al., 1997: Fischer L, Le Gros FX, Mason PW, Paoletti E. A recombinant canarypox virus protects rabbits against a lethal rabbit hemorrhagic disease virus (RHDV) challenge. Vaccine. 1997; 15(1); 90-96. [PubMed: 9041672].
2. Rohde et al., 2011: Rohde J, Schirrmeier H, Granzow H, Rziha HJ. A new recombinant Orf virus (ORFV, Parapoxvirus) protects rabbits against lethal infection with rabbit hemorrhagic disease virus (RHDV). Vaccine. 2011; 29(49); 9256-9264. [PubMed: 22001119].
3. Wiki: Rabbit haemorrhagic disease: Rabbit haemorrhagic disease [https://en.wikipedia.org/wiki/Rabbit_haemorrhagic_disease]
4. Yuan et al., 2013: Yuan D, Qu L, Liu J, Guo D, Jiang Q, Lin H, Si C. DNA vaccination with a gene encoding VP60 elicited protective immunity against rabbit hemorrhagic disease virus. Veterinary microbiology. 2013; 164(1-2); 1-8. [PubMed: 23419819].
|
|