|
|
EsxA (ESAT-6) |
|
Gene Name |
EsxA (ESAT-6) |
|
Sequence Strain (Species/Organism) |
Mycobacterium tuberculosis H37Rv |
|
VO ID |
VO_0010919
|
|
NCBI Gene ID |
886209
|
|
NCBI Protein GI |
57117165
|
|
Locus Tag |
Rv3875 |
|
Genbank Accession |
AL123456 |
|
Protein Accession |
YP_178023 |
|
Other Database IDs |
EMBL: AE000516 EMBL: AF004671 EMBL: AF420491 EMBL: BX842584 EMBL: X79562 GenomeReviews: AE000516_GR GenomeReviews: AL123456_GR InterPro: IPR010310 KEGG: mtc:MT3989 KEGG: mtu:Rv3875 PDB: 1WA8 Pfam: PF06013 PIR: A70803 TIGR: MT3989 TubercuList: Rv3875 UniProt: P0A564 |
|
Taxonomy ID |
83332
|
|
Gene Starting Position |
4352608 |
|
Gene Ending Position |
4352895 |
|
Gene Strand (Orientation) |
+ |
|
Protein Name |
ESAT-6 protein EsxA |
|
Protein pI |
4.19 |
|
Protein Weight |
9605.81 |
|
Protein Length |
95 |
|
Protein Note |
Rv3875, (MT3989, MTV027.10), len: 95 aa. esxA, early secretory antigenic target (see citations below), identical to Q57165|O84901|ESAT6 EARLY SECRETORY ANTIGENIC TARGET from Mycobacterium bovis (94 aa), FASTA scores: opt: 596, E(): 4.6e-33, (100.0% identity in 94 aa overlap). Also similar to Q50206|ESA6_MYCLE|ESAT6|ESX|L45|ML0049|MLCB628.12c 6 KDA EARLY SECRETORY ANTIGENIC TARGET HOMOLOG (ESAT-6-LIKE PROTEIN) (L-ESAT) from Mycobacterium leprae (95 aa), FASTA scores: opt: 236, E(): 3.3e-09, (36.25% identity in 91 aa overlap); and weak similarity with others proteins ESAT-like from Mycobacterium leprae. Also some similarity with O53266|ES69_MYCTU|Rv3019c|MT3104|MTV012.33c PUTATIVE SECRETED ESAT-6 LIKE PROTEIN 9 from Mycobacterium tuberculosis (96 aa), FASTA scores: opt: 131, E(): 0.03, (26.15% identity in 88 aa overlap); and other ESAT-like protein. Contains probable coiled-coil from 56 to 92 aa. BELONGS TO THE ESAT6 FAMILY. Note that previously known as esat-6.; esat-6 |
|
Protein Annotation |
FUNCTION: Not known. Elicits high level of IFN-gamma from memory effector cells during the first phase of a protective immune response (UniProt: P0A564)
SUBCELLULAR LOCATION: Secreted protein (UniProt: P0A564)
SIMILARITY: Belongs to the ESAT-6 (esx) family (UniProt: P0A564) |
|
DNA Sequence |
>NC_000962.3:4352608-4352895 Mycobacterium tuberculosis H37Rv, complete genome
CATGACAGAGCAGCAGTGGAATTTCGCGGGTATCGAGGCCGCGGCAAGCGCAATCCAGGGAAATGTCACG
TCCATTCATTCCCTCCTTGACGAGGGGAAGCAGTCCCTGACCAAGCTCGCAGCGGCCTGGGGCGGTAGCG
GTTCGGAGGCGTACCAGGGTGTCCAGCAAAAATGGGACGCCACGGCTACCGAGCTGAACAACGCGCTGCA
GAACCTGGCGCGGACGATCAGCGAAGCCGGTCAGGCAATGGCTTCGACCGAAGGCAACGTCACTGGGATG
TTCGCATA
|
|
Protein Sequence |
>YP_178023.1 ESAT-6 protein EsxA [Mycobacterium tuberculosis H37Rv]
MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQ
NLARTISEAGQAMASTEGNVTGMFA
|
|
Molecule Role |
Protective antigen |
|
Molecule Role Annotation |
The heterologous prime-boost strategy of live Salmonella vaccine expressing Mycobacterium tuberculosis fusion antigen Age5B-ESAT6 (esxA) from the chromosome followed by a systemic boost of antigen and adjuvant reduced the levels of M. tuberculosis bacteria in the lungs and spleen to the same extent as BCG. Additionally, this vaccination regimen was observed to be statistically equivalent in terms of protection to immunisation with BCG (Hall et al., 2009). In a prophylactic vaccine model, immunization with the Mycobacterium tuberculosis protein ESAT-6 with LANAC adjuvant elicited significant protective immunity against aerosol challenge with virulent M. tuberculosis (Zaks et al., 2006). |
| Related Vaccines(s) |
AER in PLGA nanoparticles + CpG + MPLA
,
Ag85B and ESAT-6 fusion protein
,
attenuated M. bovis strain WAg539
,
CTB-ESAT6-MPT64
,
Dodecin–ESAT-6
,
ERA005f
,
GamTBvac
,
H1 / CAF01
,
H107
,
H56:IC31
,
HSP90-ESAT-6-HspX-RipA
,
MVA/IL-15/5Mtb vaccine
,
recombinant S. typhimurium secreting M. tuberculosis ESAT-6
|
| References |
|
|